SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5057718|Sb06g025980 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5057718|Sb06g025980
Domain Number 1 Region: 118-390,503-631
Classification Level Classification E-value
Superfamily Subtilisin-like 4.19e-83
Family Subtilases 0.0038
Further Details:      
 
Domain Number 2 Region: 380-460
Classification Level Classification E-value
Superfamily PA domain 0.0000051
Family PA domain 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5057718|Sb06g025980
Domain Number - Region: 32-117
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000272
Family Subtilase propeptides/inhibitors 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5057718|Sb06g025980
Sequence length 777
Sequence
MDFRGIRWRKALPMCLALVALQACLPARAAAPKTYIVQMAASEMPSSFDFHHEWYASTVK
TVSSVQLEGGADDPYARIVYNYETAFHGFAAKLDEDEAERMAEADGVVTVLPETVLRLHT
TRSPDFLGISPEISNSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVPAKWKGLCQ
TGRGFTIANCNRKIIGARIFYNGYEASSGPINETAELKSPRDQDGHGTHTAATAAGAPVP
DASLFGYASGVARGMAPRARVAAYKVCWAGGCFSSDILAAVDRAVADGVDVLSISLGGGS
SPYFRDSLAIASFGAMQMGVFVACSGGNAGPDPISLTNQSPWITTVGASTMDRDFPATVT
LGNGANITGVSLYKGRRNLSSKEQYPLVYMGGNSSIPDPRSLCLEGTLQPHEVAGKIVIC
DRGISPRVQKGQVVKNAGGVGMILANTPANGEELVADSHLLPAVAVGESEAIAAKKYSKT
APKPTATLSFDGTKLGIRPSPVVAAFSSRGPNFLTLEILKPDVIAPGVNILAAWSGDASP
SSLSSDRRRVGFNILSGTSMSCPHVAGVAALIKASHPDWSPAKIKSALMTTAYVHDNTYR
SLKDAATGKASTPFDHGAGHIHPLRALNPGLVYDIGQDDYLEFLCVENLTPLQLRSFTKN
SNKTCKHTFSSPGDLNYPAISAVFAEQPSAALTVRRTVTNVGPPSSTYHVKVTEFKGADI
VVEPSTLHFTSSNQKLTYKVTMTTKVAQKTPEFGALSWSDGVHIVRSPLILTWLPPM
Download sequence
Identical sequences C5YE56
4558.Sb06g025980.1 jgi|Sorbi1|5057718|Sb06g025980 XP_002448366.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]