SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5057790|Sb06g027350 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5057790|Sb06g027350
Domain Number - Region: 283-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0879
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5057790|Sb06g027350
Sequence length 328
Sequence
MPRGRNRRSAADAVARPLALTLALVSTLPRAAHSQDPALPPLRPPGRRTTTTCDNVPEPF
GRRNESHLPLPGFGVICGPKGEAMLSIGEHEYRIDSVSVSVPGSYVVIFAEPITQVCYDG
KGKPTPDTGTGGPKSLDGTPFTFSKRNKLVNFGCNRTLVANFFNLPGDPIPQYTTSCTTT
CYTPNISGSCLGEACCEASMDQMNGAKAFSLSFERTTANGSGGDSVEDDGTCSVAFFLDK
DEAAFNFSGDEVRPLKKALLPQGERRMILDWAIGSTTCDQAQSYTFEPLCKHGYGTCVDA
PSGVGYVCKCPDGYDGNAYISDGCQDYL
Download sequence
Identical sequences 4558.Sb06g027350.1 jgi|Sorbi1|5057790|Sb06g027350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]