SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5057841|Sb06g028180 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5057841|Sb06g028180
Domain Number 1 Region: 97-166
Classification Level Classification E-value
Superfamily PA domain 0.00000628
Family PA domain 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5057841|Sb06g028180
Domain Number - Region: 514-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00272
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 295-401
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0589
Family Thioltransferase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5057841|Sb06g028180
Sequence length 633
Sequence
MAIHVQGHERRLAAVACLVVTMASLASARFIVEKNSIKVLSPRSLRGHHEAAIANYGVPD
YGGTLTGVVLYPDAKLATACKPFGGEKLRSPSGRPVVLLVDRGGCYFALKTWHAQLAGAA
AVLVADSADEPLLTMDSPEEETPDMAFLANITVPSALVSKKFGDALRLAASDGDKEEEVV
VRLDWRESMPHPDERVEYEFWTNSNDECGPRCDEQAAFVRAFRGHAQLLEKGGYALFTPH
YITWFCPDAFLETPQCKAQCINRGRYCAPDPEGDLRAGYDGKDVVVENLRQLCVHRVANA
SGRPWVWWDYVVDYHLRCSMKDNKYSSACAQDVVRSLGLPMDKIDKCMGDPDADAENDVL
RTEQIVQVGHGARGDVTILPTLVINNVQYRGKLESTAVLKAICAGFKESTEPHVCLTPGM
ETDECLNNNGGCWRDEKTNVTACKDTYRGRICQCPVVDGVQYQGDGYTDCKAVGLGRCAM
DNGGCWKETRQGKTFSACSDPELSGCKCPPGFEGDGFHCQDVDECRDKLACSCPHCSCKN
MWGGFDCKCNSGMIYIKNEDTCIAKEMSAFGWLVTALVLSCVAGIGIAGYLFYKFRLRRY
MDSEIMAIMAQYMPLDSQHNENQPLRTEEAQQA
Download sequence
Identical sequences jgi|Sorbi1|5057841|Sb06g028180 XP_002447079.1.57931 4558.Sb06g028180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]