SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5057941|Sb06g029740 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5057941|Sb06g029740
Domain Number 1 Region: 505-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-80
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 81-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-25
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5057941|Sb06g029740
Sequence length 837
Sequence
MAVLNLLALIFATLLLLLRRSSGAGAGISSDTLNNGGNITDGETLLSAGGSFTLGFFSTS
TTVPTKRYLGIWFTASGTDAVLWVANRDTPLNTTSGVLVMSSRVGLRLLDGSGQTAWSSN
TTGVSASSVAQLLDSGNLVVREQSSSASASATFQWQSFDHPSNTLLAGMRFGKNLKTGVE
WSLTSWLAKDDPATGAYRRVMGTRGLPDIVTWHGSAKKYRAGPWNGRWFSGVPEMDSQYK
LFNIQMVDGPDEVTYVLNTTAGTPFTRVMLDEVGKVQVLLWISSSREWREFPWLPRDACD
DYALCGAFGLCNVGAASAPSCSCAVGFSPVNSSEWSRKESSGGCQRDVQLECGNGTAATD
RFTLVPGVKLPDTDNATVDMGATLDQCKARCLANCSCVAYAPADIREGNGTGCVMWTDNI
VDVRYIENGQDLYLRLAKSESATGKRGRVAKILVPVMVSVLVLTAAGLYLVWICKLRAKR
RNKDNLRKAILGYSTAPYELGDENVELPFVSFGDIAAATNNFSEDNMLGQGGFGKVYKGT
LGQNIEVAIKRLGQSSGQGVEEFRNEVVLIAKLQHRNLVRLLGCCIDGDEKLLIYEYLPN
RSLDSIIFDAARKYLLDWPTRFKIIKGVSRGLLYLHQDSRLTIIHRDMKTSNILLDADMS
PKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGAFSVKSDTYSFGVIILEIISG
LKISLTHCKGFPNLLAYAWSLWIDDRAMDLVDSSLAKSCFHNEALRCIQIGLLCVQDNPD
SRPLMSSVVTMLENETTPVPVPIQPMYFSYRGTTQGTEENTSSSTNNMSLTTVLEGR
Download sequence
Identical sequences 4558.Sb06g029740.1 jgi|Sorbi1|5057941|Sb06g029740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]