SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5057942|Sb06g029800 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5057942|Sb06g029800
Domain Number 1 Region: 502-795
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-76
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 82-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.46e-25
Family alpha-D-mannose-specific plant lectins 0.0063
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5057942|Sb06g029800
Domain Number - Region: 352-417
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0251
Family Anti-platelet protein 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5057942|Sb06g029800
Sequence length 842
Sequence
METSCRSHLLDLLLLSLLLSPIPPRAFAADDVAGDTFSKGRNITDNETLVSANGAFTLGF
FSPGVSSKRYLGIWFSVSGDAVCWVANRDRPINDNSGVLMVSDTGSLLLLDGSAGRIAWS
SNSSSTSPVEAQLLDVGNLVVRSRGSAAILWHSFDHPSNVLLSGMKVGRDFSTGAEWYLT
SWRSADDPSPGAYLRKLDTSGRPDNVVWHGGVKTFRTGPWNGVRFGGIPEVLAYQEGLFD
YQMVMSSREVTYGYNARRGAPFTYVVLTDGGVVKRLVWDASSRAWQTAYQGPRDVCDEYG
RCGAFNLCNISAAATSFCRCLAGFGLASPSRASGACRRNVALDCAANGKTTTDGFLVVPG
TKLPDTHNSSVDTGITLDACRARCLANCSCLAYAAADTSAGGSGTGCIMWADDLLDLRYV
EQGQDLYLRLAASELPPPLSPPASGSRSRAFPTAPVVAASVASFVGILLIAFLVLVVIRR
RRRRPPIPAAQSIIPLPPTDHPTIVQCTPPPTVPYVELSSLMRATGDFSESNIIGRGGFG
IVYEGHLPDGRKVAVKRLIRPSDADEGSDAFMREVKVMSKLRHGNLIQLLFYCKDGNERV
LVYEYMKNKSLDRYIFGGDPRLRALLNWEQRLEIVRGVARGVAYLHGLSEEVIHRDLKPS
NILLDDNWRPKVADFGTAKLFVVDQTNPTIIESAGYTAPEYSNERYLTLKCDVYSFGIIL
LEIVSGRRNRTTPTLLSDAWESWNQSRTRDLLDPAVGQPEPELLFELERCVQIGLVCVQQ
SPDDRPAMSAVVARLNNNGLQIRPPKRPVLDSSTESPALHEADRSSQEASGTSRSSYSIY
LT
Download sequence
Identical sequences C5YGP6
jgi|Sorbi1|5057942|Sb06g029800 4558.Sb06g029800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]