SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058052|Sb06g031660 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058052|Sb06g031660
Domain Number 1 Region: 180-308
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.43e-31
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 2 Region: 85-177
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.51e-23
Family Cold shock DNA-binding domain-like 0.00013
Further Details:      
 
Domain Number 3 Region: 44-82
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000392
Family ECR1 N-terminal domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058052|Sb06g031660
Sequence length 319
Sequence
MKDRHLSLNQTQRVRLEAALHELQSLAPAAASAAAVTVADTIPVNQEDNILKGHGTSDQD
GEVVATLCGVVERVNKLVYVRTLRARYKPEVGDIIVGRVIEIAPKRWRLEINFSQDAVLM
LSSMNLPDGIQRRRTAVDELNMRSIFEENDVICAEVRGFQHDGSLHLQARSEKYGKLERG
QLLMVPPYLVKRKKQHFHHLEQYNVDLILGCNGFIWVGEHVVVGETTKTTGGQQRFSTEA
ENFTPLETRKHICRLANAVRVLSALGFTLIVELIIETMEASVSSNVEINAMLGAEFYVQT
AEREAKRRADLLRKKNGAR
Download sequence
Identical sequences C5Y9M2
XP_002447269.1.57931 jgi|Sorbi1|5058052|Sb06g031660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]