SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058076|Sb06g032000 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058076|Sb06g032000
Domain Number 1 Region: 165-243
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 271-302
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000445
Family CCCH zinc finger 0.0018
Further Details:      
 
Domain Number 3 Region: 103-135
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000235
Family CCCH zinc finger 0.0027
Further Details:      
 
Domain Number 4 Region: 38-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000288
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058076|Sb06g032000
Sequence length 306
Sequence
MEGAGAARKRSRPESANGYAAGGKRSKDTESFQTGQSSKSKPCTKFFSTIGCPFGEGCHF
LHFVPGGYPAVAKMLNLGSPAVSAPSRTHVDHAALTGASHQASMGKTRMCTKYNTTEGCK
FGDKCHFAHSERELGKPAYMSHEGPPMGGRYGGRPEPLQQASMGPPAGNFGASATAKISV
DASLAGGIIGKGGVNTKQISRVTGVKLSIRDHESNPSQKNIELEGNFDQIKQASDMVRDL
IATISASMPAKNLSASAAPAGGRGGGLGGRSNYKTKLCENFVKGACTFGDRCHFAHGETE
QRRGAA
Download sequence
Identical sequences C5Y9Z9
XP_002447282.1.57931 jgi|Sorbi1|5058076|Sb06g032000 4558.Sb06g032000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]