SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058208|Sb06g034040 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058208|Sb06g034040
Domain Number 1 Region: 215-277
Classification Level Classification E-value
Superfamily RING/U-box 1.57e-17
Family RING finger domain, C3HC4 0.0029
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily PA domain 0.00000000942
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058208|Sb06g034040
Sequence length 501
Sequence
MKSSRFLFLCAMFCLMARLGAANVVLMGNNLTLSFDDIEASFSPGVKGSGVSGVVYASEP
LNACSPLTIKTVNGPPSPFALIIRGGCTFDEKVKNAQDAGFKAAIVYDNKNSGVLVSMAG
SSSGIHIYAVFVSKASGEVLKKFSGNMDVEVWILPTFENSAWSIMAISFVSLLAMCAVLG
TCFFVRRHRIRREHPRIAEDREFHGMSSQLVKAIPSLIFTKVQEDNCTSSMCAICLADYN
VGEKLRVLPCRHKFHAACVDLWLTSWRTFCPICKRDARSGASEVVATEATPLLSSAARLP
SFRSSVAASPPRPISRHPSSHSVSRAYSVSSTPNSPNPFISSHISSPGIRASRSITDLGN
ISSLHPRISHLSSTHSLVGSHLSPPISIRYWSSHVAHSGYGSPSPHVSSSYISNSGYGSS
SYCYLGLGGSSHSQHGTYLRRCGESGPSLCTMVPQQLQWETNVAAGASSAKSLRQSSYLR
HCGDSDASLSDMTSAQSLPRC
Download sequence
Identical sequences C5YB45
jgi|Sorbi1|5058208|Sb06g034040 XP_002447380.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]