SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058255|Sb07g000650 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058255|Sb07g000650
Domain Number 1 Region: 868-942
Classification Level Classification E-value
Superfamily RING/U-box 8.99e-19
Family RING finger domain, C3HC4 0.0039
Further Details:      
 
Domain Number 2 Region: 465-537
Classification Level Classification E-value
Superfamily PA domain 0.000000719
Family PA domain 0.011
Further Details:      
 
Domain Number 3 Region: 315-350
Classification Level Classification E-value
Superfamily PA domain 0.00000327
Family PA domain 0.011
Further Details:      
 
Domain Number 4 Region: 390-425
Classification Level Classification E-value
Superfamily PA domain 0.00000327
Family PA domain 0.011
Further Details:      
 
Domain Number 5 Region: 598-639
Classification Level Classification E-value
Superfamily RING/U-box 0.00000411
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 6 Region: 733-774
Classification Level Classification E-value
Superfamily RING/U-box 0.00000411
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058255|Sb07g000650
Sequence length 1691
Sequence
MACPRGRTSLPLCFFLMICLMAQLGASNVVLMANNTTLSFDDVEATFSDWCFQPGGTQGG
EFCQDGMSKGKDIIAPLFLSDDLPHGSAGSFQCCTHGEQHYPVVRXCXGNFXPMHFSYPW
RRLWIPGKFXMDHHVLFSHDCGKEIPPAFRKQAGCVKKWITLTCDFVILGLSTTYYTIWV
VIQLCRLFVLLXSYASPASNFNFIDVSSVLQLFXVIGAFNLVVLKEESSVKMACPRGRTS
LPLCFFLMICLMAQLGASNVVLMANNTTLSFDDVEATFTPAVKGSGVNGVLYAVEPMDAC
SPLRTKAIEGSASPFALVIRGGCQFDDKVRNAQNAGFKAAVVYDNEDNGILVSTPAVKGS
GVNGVLYAVEPMDACSPLRTKAIEGSASPFALVIRGGCQFDDKVRNAQNAGFKAAVVYDN
EDNGILVSTPAVKGSGVNGVLYAVEPMDACSPLRTKAIEGSASPFALVIRGGCQFDDKVR
NAQNAGFKAAVVYDNEDNGILVSMAGSSSGVHIYAVFVSKASGEELKKYSSQTDAELWII
PTYENSAWSIMAISFISLLAMSAILAACFFVRRHQIRRDRARLPQVREFHGMSSQLVKAM
PSLIFTKVQEDNCTSATCAICLEDYSVGEKLRVLPCRHMAGSSSGVHIYAVFVSKASGEE
LKKYSSQTDAELWIIPTYENSAWSIMAISFISLLAMSAILAACFFVRRHQIRRDRARLPQ
VREFHGMSSQLVKAMPSLIFTKVQEDNCTSATCAICLEDYSVGEKLRVLPCRHMAGSSSG
VHIYAVFVSKASGEELKKYSSQTDAELWIIPTYENSAWSIMAISFISLLAMSAILAACFF
VRRHQIRRDRARLPQVREFHGMSSQLVKAMPSLIFTKVQEDNCTSATCAICLEDYSVGEK
LRVLPCRHKFHAACVDLWLTSWRTFCPVCKRDANAGTSNLPVSESTPLLSSSAIPLPEST
ALASFRSTVAASPPRPISRHPSSQSISRNYSISGSSIPRTPNPRFYANSSPFCTLANMSS
SWSRTSHLASAHSLCGGHLSPPIDIRNTSQHISRSAYGSPSRYIGSSHMSHGSPSYYLGS
SGQRIPYLRHCTLSGPSLFTMVPQSPQQNQSQHGGDSETNLSAAASTQSFRQLYLQHCPD
SDTSSQSLPGCXFLLQNSPFXQXWWLQXAPMRNLIWYQIDMWIXSREHNSPXXXNKVXQL
LVRRENRQPQNVSNFTCXVYREFGVVLDLPTFEARNAVIGYFCSIVDVLLYLEEANALVW
FHERLACTDTTLXEPXMLFVYXFLSLXFFFXFSSXVPCSLCGPMAHLLENILPCMQAGRK
CWNIKPSCIRVYPFAFIICHSLTRINCFGFLPVYSSSISPQANQPASFITVHIPQLLHFG
FQYPSHPXPXVLCKLISFLHPCKYVILMVSHFAPCICSLFVRWPLVPTNRHQEYLTTHLP
FGLWISQSLHRLITHVPWISELLPWIFRAADSLPEALHVVRPEPVHHGAPVTATEPVAAR
WRLGNKSVSCCINSVIPSALPAALSXFXHVISVASGVLILAAKFTILTMMVAPVSSNEKS
YLVPNXHVDLISXTXFTMMIKXGVTTACKKRESATPECEQFYLLSVQGVWSSFGFAYFXG
TXCSHRLLLFNSXCVALSXRSKCPCLVSRAFSVYXYNFVGTLDAVCLLIFEPVIFLLIFI
SSMQLVWTYGS
Download sequence
Identical sequences jgi|Sorbi1|5058255|Sb07g000650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]