SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058283|Sb07g001150 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058283|Sb07g001150
Domain Number 1 Region: 175-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000071
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058283|Sb07g001150
Sequence length 761
Sequence
MATKLDHSSAEHRQAKSTAPSSLTPKISMFGAKAGFVIPKNKLAGSLVVRSTSAKNETPV
ASREDSSRHVQRKTKWAPDLALDPVVCKGRALAYQTRVEQITKKLKSGTLDTSEIDGSLS
AGNDLNYIGSDVLKENELGNVELLELERRELIGEILRLNPGYKTPENYKPVLKETKVPLP
AEAHPGHNIIGVLLGPESNTQKRLHEETGAVIRVYGTKKINGEKNEIRHQDINEAQDAYE
DLYINVSADSYDKVDAAVVLIELLLAPVSVKSTATSTTTAVPSEVTSKDAVSANVQLVQN
TTSQPDLLHYQSHNAPWLPTPQTNAPSIPSMGPVLSTLPNNSLQPQPPAGSFSMLPYTGQ
PPHMNSMPRNPFPVPGPQQSTPSNQQHPPQFRANNSSIGPSFGQPPVIVSPHMTPSSSMP
PPVRPLQIPHPSGGWPPFSPVTPQSQRPLQASPTFMAVRPPISVSPVGATPPQGPVALAP
SNMPTMYRGQHPPVPNFTGSAPFVSRPPGGPQSFPTAVPQGPSSVAFPGGASPQSPYPPT
PDQMRGPPPAFSPVGSTPGMVPPSIASSGPPAPGPASTSGSQAQMAPLRPPLPVMGDFTF
RPVVSPAPTPDFAAPSSQMGIQDRTHPGPFFPPSNQNPNQGFQRPFDGRPMNMMGQPRMH
PPPPHFHGAFSRNPSPLEFPAGFQGVWPAVQAPHMPAPSNPSNFLPSRTFQLRPPPQQDM
SGAGGNRQGGNQIYNPFAPTAAQRTETDPEYEDLMASVGVK
Download sequence
Identical sequences C5YLX5
jgi|Sorbi1|5058283|Sb07g001150 XP_002444905.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]