SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058513|Sb07g005630 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058513|Sb07g005630
Domain Number 1 Region: 303-371
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000033
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 384-465
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000891
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 3 Region: 130-219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 4 Region: 36-92
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000361
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 561-626
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058513|Sb07g005630
Sequence length 629
Sequence
MRQHTGKRPRQHREYEREERKDQHKRPFPHAQESSNNDGLVLYRILCPDSLIGSVIGKNG
NVINAIRQQTSAKVKVVDPYPGADKRVILVYCYVKHRDLDAEVDDNEPVCAAQDALLRVH
NAIVDTLHRNRRDSDKKNTEEANILVPASQASNVIGKSGAVIKHLRSTSRAFIKVSPKDP
SDATHSCAMSFDNFVQITGGAEAVKKALFGVSTIIYKHPSKENIPLETSIPEPTPSIIIP
SELPVYPASNFYSAPDAAIPSVHPSLSILGSTHHVPELALPADDHGRLPIYPSILPVIPT
YSAPKCSGELEFRVLCPSGKIGLVIGRGGATIKNIRQESGARIDVDDAKNDREESIITIT
STEAIDDVKSAAVEAVLLLQAKINDYEDDRMNLRLLVPNKVIGCLIGRGGSIVNDMRKKT
KANILISKGDKPRRASSSDELVEVSGEADKLRDALVQIILRLREDVLKESVESQNSDRDG
KLTVATSDSLYGSSLSLPALLPHNPQIAPLSYDRRGESERALEVFPRTSSYGYSSMQVTD
DGYGGLPSYTSKAYEEHLPRDEMTIPASGLSKVMGKRGTNLDNIRKISGAHIEIIESKSS
RHDHIAYISGTSEQRQSAENLIKAFIMST
Download sequence
Identical sequences C5YIF0
XP_002444000.1.57931 4558.Sb07g005630.1 jgi|Sorbi1|5058513|Sb07g005630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]