SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058774|Sb07g021550 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058774|Sb07g021550
Domain Number 1 Region: 406-666
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.61e-68
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 296-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000978
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058774|Sb07g021550
Sequence length 678
Sequence
MAIHFLTCLLLLLAASAAAAAADVESTSGRCVDSCGGMSIQYPFGIGAGCFRKGFEIICG
DGGRPVLAGTTMPIPVNHLSIRTAEARVTLPIGWECFNASDEVHAWSDGDVQFNQEDVYR
ISNTHNHLVVVGCNTLGYIQGQRTQGSDDYPFAYYTGCMSFCNDSRSAVDGACAGVGCCR
VDIPAGLTDNKMYFREYTHKARLDYSPCDYAFLVEKENYTFHAADLRMDVNRTMPVWLDW
AIRDNNGLTCAEAKKEAQGYACVSSNSECHDSFNGPGYVCNCSMGYEGNPYVVNGCTDIN
ECEHDEYPCRGFCQNTLGSYECRCPSGFHSADPFNEPCNLRLPLGVVIASGVAGCILIIS
VVVFVWLLRKEKRKNKEYFGKNGGPTLEKVTKIKLFKKKELEPILRSTNRIGEGGFGEVY
KGILGDEPVAVKKPKNANLADQFTNEVIIQSRVMHKNIVKLIGCCLEVDIPILVYEFVPK
GSLDDILHVTREPLDLDQRLDIATQSARGLAYLHSDTTTTILHGDVKPANILLNDDLIPK
ISDFGISRMITVDKKYTRNVIGAVSYVDPIYLQSGRLTTKSDVYSFGIVLLELITRKKAS
DSNGLLSNFLDCYTKDKKVIELVDSEIAVTGNMELLHSVAGMILKCLDLNVDQRPEMIDV
AENLRFLLKRSRREKIEI
Download sequence
Identical sequences 4558.Sb07g021550.1 jgi|Sorbi1|5058774|Sb07g021550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]