SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5058809|Sb07g022170 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5058809|Sb07g022170
Domain Number 1 Region: 116-379,511-639
Classification Level Classification E-value
Superfamily Subtilisin-like 8.25e-75
Family Subtilases 0.0078
Further Details:      
 
Domain Number 2 Region: 34-113
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000425
Family Subtilase propeptides/inhibitors 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5058809|Sb07g022170
Domain Number - Region: 415-487
Classification Level Classification E-value
Superfamily PA domain 0.00146
Family PA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5058809|Sb07g022170
Sequence length 805
Sequence
MPPPPHYYPVLLPLLVLAAVAGGGGGEADGLERTYIVRVDADAKPSVYPTHAHWYEAAVL
AAAGDGAGWPEGGPLIHTYSAAFHGFSARMSPAAAQALASAPGVAAVVPERVRQLATTRS
PRFLGLLSSPPSALLADSDFGADLVIAIVDTGISPAHRSFHDRGLGPVPSRWRGVCASGP
GFPPSACNRKLVGARFFSKGYEATSGRMNETAEVRSPLDTDGHGTHTASIAAGRYVFPAS
TLGYARGVAAGMAPKARLAAYKVCWVGGCFDSDILAAFDAAVADGVDVVSLSVGGVVVPY
YLDAIAIGAFGATEAGIVVSASAGNGGPGGLTVTNVAPWMATVGAGSMDRAFPANVRLGD
GQVLDGVSVYGGPALESGRMYELVYAGASGDGGGGASSASDGYSASMCLDGSLDPAAVHG
KIVVCDRGVNSRAAKGDVVHRAGGIGMVLANGAFDGEGLVADCHVLPATAVGAAAGDRLR
KYIASSTKQRPATGTILFEGTHLGVHPAPVVAAFSARGPNPQSPEILKPDLIAPGLNILA
AWPSGVGPAGIPSDIRRTEFNILSGTSMACPHVSGLAALLKAAHPTWSPAAIKSALMTTA
YVRDNSNGTMVDESTGAVAGAFDFGAGHVDPMRAMDPGLVYDIGPGDYVNFLCNLNYTEQ
NIRAITRRQADCRGARRAGHAGNLNYPSMSATFVAAADGARETTTMRTHFIRTATNVGGG
GKAVYRASVQAPEGCNVTVQPRQLAFRRDGQRLSFTVRVEAAVAAAPGKRMEPGSSQVRS
GALTWSDGRHVVRSPIVVTVQAPLQ
Download sequence
Identical sequences C5YLS7
XP_002444456.1.57931 jgi|Sorbi1|5058809|Sb07g022170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]