SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5059054|Sb07g026780 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5059054|Sb07g026780
Domain Number 1 Region: 519-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-77
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 111-187,286-310
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-24
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5059054|Sb07g026780
Domain Number - Region: 395-438
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00173
Family Hairpin loop containing domain 0.087
Further Details:      
 
Domain Number - Region: 198-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0285
Family Glycosyl hydrolases family 16 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5059054|Sb07g026780
Sequence length 847
Sequence
MAPSNLLFLLLLLATATPLITGQLSDYPTANLSTLWTNNNASLKHSITYADGSIVRAIVL
RSPKAAFYGPSFAAGFFCPSAPCDTGDFLFAVFIVYTNSGAGITSVVNGIPQVVWSANRV
HPVKENATLELTGDGNLILRDADGASVWSSGTAGRSIAGMMITELGNLVLFDQKNATVWQ
SFEHPTDALVPGQSLLEGMRLTANTSTTNWTQNQLYITVLHDGLYAYVDSTPPQPYFSRL
VTKNLVTKNKTGNQPTLFTLTNGSFSIFVQSTPDPYSSIPLPEAKSTQYMRFESDGHLRL
YEWSNTEAKWVMVSNVIKMYPDDDCAFPTVCGEYGVCTGGQCSCPFQSNSTSSYFKLIDG
KKPNIGCMPLTPISCQEIQHHELLTLKDVSYFDINTSHTIANARNSDDCKKACLKNCSCQ
AVMFTYGQNESNGDCLWVTRVFSLQSVQPQILHYNSSAYLKVQLSPSPSATTANKKKAIL
GAIIGGVTGVVLVLIVVTLYVQKRRKYHEIDEEFDFDQLPGKPMRFSYAKLRECTEDFSQ
KLGEGGFGSVFEGKLNEERIAVKRLESARQGKKEFLAEVETIGSIEHINLVRLVGFCVEK
AHRLLVYEYMPRGSLDRWIYYRHNNAPLDWSTRCRIIMDIAKGLCYLHEECRRKIAHLDI
KPQNILLDDNFNAKLADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDIYSF
GVVVMEVICGRKNIDNSQPEESIHLITLLQEKAQNNRLIDMIDKQSHDMVTHQDKVIQMM
KLAMWCLQHDSSRRPLMSMVVKVLEGTMTVETSIDYNFFSSDPVLSVQTDQSAYSAPPLA
SILSGPR
Download sequence
Identical sequences C5YI84
XP_002445840.1.57931 XP_021320517.1.57931 jgi|Sorbi1|5059054|Sb07g026780 4558.Sb07g026780.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]