SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5059322|Sb08g003020 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5059322|Sb08g003020
Domain Number 1 Region: 95-168,273-300
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000196
Family alpha-D-mannose-specific plant lectins 0.0086
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5059322|Sb08g003020
Domain Number - Region: 372-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000196
Family Hairpin loop containing domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5059322|Sb08g003020
Sequence length 521
Sequence
MRQAKCDPAIAAAVVVLLVLLYVGSPVVLPVDGAKGEEELTTQLINGFTATHAAGSAATF
EPLLYATSAVFALGFLRVGQASLDLAVVHLPSSFPVWRATPANLGDWSRPATLTFDTSLV
LTAHDGAVLWRTLNAAGDVVALLNSSNLVVQRYARPVPAWQSFDHPSDTLVVDQNFTASS
PPLISGNRRFALRLGKTYVALHMEFDGGRATTTAPAYWKHTALEAQPENATAPPVYGRLD
GLGFFGLYLEGGGGHPTVDVLSFDTFVLNLTGVFRRMTVDDDGNLRAYYWSSDAKAWTSD
YKAIAERCELPTSCGAYGLCVPGNAQCQCLDSNGTSTTSSPPCHAVEETGDLCSNGLRQP
DFDVVRRTRVSVAYKEELPVQTNTTAERCEMACARNCTCWGAVFNGASGYCYLIDFPVET
LVYQADDRMVGYFKIRKAAATATRRSARRGMSPGVTAATVVLSLVLVALAAAGAYWGYRM
WEKRKRKRAGMEQELAPGPYKDLKSMASSNSSFKSSHEFQP
Download sequence
Identical sequences C5YRQ1
4558.Sb08g003020.1 jgi|Sorbi1|5059322|Sb08g003020 XP_002441830.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]