SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5060272|Sb09g007250 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5060272|Sb09g007250
Domain Number 1 Region: 529-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-76
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 1425-1522
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.66e-20
Family Protein kinases, catalytic subunit 0.0019
Further Details:      
 
Domain Number 3 Region: 84-196,228-254
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-20
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Domain Number 4 Region: 980-1092,1124-1150
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-20
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5060272|Sb09g007250
Domain Number - Region: 415-451
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Pan module (APPLE domain) 0.037
Further Details:      
 
Domain Number - Region: 1311-1347
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Pan module (APPLE domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5060272|Sb09g007250
Sequence length 1522
Sequence
MNPLLHKLLTLLLLASLHTPPYSSSAAAAAAAATTTTTTVTDTLAAGQALAFGDKLVSRN
GKFALGFFQPTAVISKSRNITSPNWYLGIWFNKIPVLTTVWVANRDTPITDPKRKQTHLK
ISSDGNNLVIVTQASPETETLVWSTPTPSVNRSGASLNSTTTTAVLLDSGNLALLELASP
SSSNVTLWQSFDYPTDIVLPGAKFGRNKVTGFTRQGITWKSRIDPGLGSYSVEIDASGVV
LKRLNPLVVYWRWSSSPTSTLKLIPILKSILELDPRTKGLIDPTYVDNSQEEYYMYTLLN
DSSLTFVSLDISGQIKMNVWSHAQQSWQAVHAQPADPCTPYATCGPFTTCNGTSLSSFCD
CMPSFSQKSAQDWELDDRTGGCIRNTPLHCSSEKNTTSSTDIFRPIPHVTLPYNFQSVDG
VNSQSNCEEACLSSCSCTAYSYNSSRCSVWHGELFSVNQNDGIDNNSKDVLYLRLAADDL
PSLTRNKRKPSVGVVTAASIIGTGLLMLMLLLMMWRKKSKWCGTPLYDSQGGGVIAFRYT
DLSHATKNFSEKLGAGGFGCVFKGVLSGSTTIAVKRLDGARQGEKQFRAEVSSLGLIQHI
NLVRLIGFCCKGDKRLLVYEHMSNGSLDAHLFQSNAAGLNWNNRYQIAIGVARGLSYLHQ
SCRECIIHCDIKPENILLDASFVPKIADFGMAAFVGRDFSRVLTTFRGTAGYLAPEWLGG
VAITSKVDVYSFGLVLLEIISGRRNSPEAYSSNNYHIEYFPVRAISKLHEGDVRSLVDPQ
LHGDFSLEEVERVCKVACWCIQDNELHRPTMGEVVHVLEGQQEIDMPPMPRLLAAITQGA
GAITEISNASSMXXIHRLLIFVSENFNAHIWSKVIEEGQPERPSIVTXSYFQSCFSMNPL
LHKLLTLLLLASLHTPPYSSSAAAAAAAATTTTTTVTDTLAAGQALAFGDKLVSRNGKFA
LGFFQPTAVISKSRNITSPNWYLGIWFNKIPVLTTVWVANRDTPITDPKRKQTHLKISSD
GNNLVIVTQASPETETLVWSTPTPSVNRSGASLNSTTTTAVLLDSGNLALLELASPSSSN
VTLWQSFDYPTDIVLPGAKFGRNKVTGFTRQGITWKSRIDPGLGSYSVEIDASGVVLKRL
NPLVVYWRWSSSPTSTLKLIPILKSILELDPRTKGLIDPTYVDNSQEEYYMYTLLNDSSL
TFVSLDISGQIKMNVWSHAQQSWQAVHAQPADPCTPYATCGPFTTCNGTSLSSFCDCMPS
FSQKSAQDWELDDRTGGCIRNTPLHCSSEKNTTSSTDIFRPIPHVTLPYNFQSVDGVNSQ
SNCEEACLSSCSCTAYSYNSSRCSVWHGELFSVNQNDGIDNNSKDVLYLRLAADDLPSLT
RNKRKPSVGVVTAASIIGTGLLMLMLLLMMWRKKSKWCGTPLYDSQGGGVIAFRYTDLSH
ATKNFSEKLGAGGFGCVFKGVLSGSTTIAVKRLDGARQGEKQFRAEVSSLGLIQHINLVR
LIGFCCKGDKRLLVYEHMSNGS
Download sequence
Identical sequences jgi|Sorbi1|5060272|Sb09g007250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]