SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5060294|Sb09g008070 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5060294|Sb09g008070
Domain Number 1 Region: 508-804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.94e-75
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 65-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-26
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 
Domain Number 3 Region: 342-392
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000824
Family Pan module (APPLE domain) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5060294|Sb09g008070
Sequence length 809
Sequence
MPRFLATLLSTASILSFIALLPRVASRDTLSLGSSLRVESYETSILQSSDGTFSSGFYQV
YTDAFTFSIWYSKAANKTIVWSANPDHPVHARRSAITLHKDGNMVLTDYDGAVMWQADGN
FTDVQRARLLNTGNLIIEDSRGNTVWQSFDSPTDTFLPTQLITATTKLVPTTQSHSPGNY
IFRFSDLSVLSLIYDVPEVSDIYWPDPDQNLYQDGRNQYNSTRLGVLSHSGVLASSDFAD
GQPLVASDAGPDIKRRLTLDPDGNLRLYSLNSSDGSWSVSMAAMSQPCNIHGLCGPNGIC
HYSPKPTCSCPPGYEMRNPGNWTEGCMAIVNITCDHYDNKSMKFVKLPNTDFWGSDQQHR
LSVSLQTCKNICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVRTIYLKLPTRVNV
LNVPIPRSNVFDSVPHHLDCDQMNKNISEPFPNVHKTSRGESKWFYFYGFIAAFFVVEVS
FISFAWFFVLRRELKPSELWAAEEGYKVMTSNFRRYSYRELVKATRKFKVELGRGASGTV
YKGLLEDDRQVAVKKLENVKEGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEY
VENGSLANILFNEKSNILLDWKGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQ
TFEPKITDFGLAKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLEL
VTGTRVLELVEGPDEVHNMLRKLVRMLSAKLEGEEQSWIDGFVDSKLNRPVNYVQARTLI
KLAVSCLEEDRSKRPTMEYAVQTLLSADD
Download sequence
Identical sequences C5YV85
4558.Sb09g008070.1 XP_002439493.1.57931 jgi|Sorbi1|5060294|Sb09g008070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]