SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5060695|Sb09g023640 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5060695|Sb09g023640
Domain Number 1 Region: 143-260
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.22e-31
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5060695|Sb09g023640
Sequence length 285
Sequence
MDGLHGTDACFSPARAISPQVRPPAGPPDVGSQYLAELLQEHQKLGPFMQVLPICSRLLN
QEIMRVSNIRRQHGAAGDFDRFPPASPNQMHPSPPMPNFCGNGFSPWNGMQSERVGVPQG
AMGWQGPPQSPGSYIVKKILRLEVPTETYPNFNFIGRLLGPRGNSLKRIEASTGCRVFIR
GKGSIKDSGKEEQLKGRTGYEHLSEPLHILIEAELPANVIDARLAKAQEILEELLKPVDE
SQDYYKRQQLRELAMLNSPLREESPHPGGAPPSPFSNGGMKRVKQ
Download sequence
Identical sequences C5YZU7
XP_002441276.1.57931 jgi|Sorbi1|5060695|Sb09g023640 4558.Sb09g023640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]