SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5060749|Sb09g024740 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5060749|Sb09g024740
Domain Number - Region: 16-58
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000199
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5060749|Sb09g024740
Sequence length 367
Sequence
MRLGVDFAAGTNMTLTAWASPSDPSPSPVVAAMDTSGDPEVFIWNGGTKVWRSGPWDGVQ
FTGVPDTITYKGMGFSFRFVNDGREATYSFQVRDAGIVSRLALNSTAGGIIGGGGLLQRW
TWLESAAAWGLYWYAPKDQCDAVSPCGPNGVCDTNKVPACSCLPGFTPRSPASWAMRDGR
DGCVRATPLDCGGNANRSSSTDGFAPLPHAKVPDTTRAVVDYGSSLDQCRQRCLRNCSCT
AYASANLTGAAGHRGCVMWTGGLEDLRVYPSFGQDLYFRLAAADLGTSLGKSKKKVSMAI
SVVVSITAALAVLLAITGLLIWRAKKTKARKPGDILSLQTVDIPERDDKTYINVNLLLDV
ILTLVFS
Download sequence
Identical sequences jgi|Sorbi1|5060749|Sb09g024740 4558.Sb09g024740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]