SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5061367|Sb10g004810 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5061367|Sb10g004810
Domain Number 1 Region: 336-623
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-74
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5061367|Sb10g004810
Domain Number - Region: 242-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00116
Family EGF-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5061367|Sb10g004810
Sequence length 679
Sequence
MEGFDLECNKTEDGSANVTFFGSMPLLNISLLHGEIRVKHHISSMCYNLSSRSISYREGG
MKLDNTPFTFSELRNRFIVIGFNTLAYMIGSTSVLGCWARSKNIKEAQDGVCEGVGCCQV
VLTRNMSDYDAGFNDRYNTTNISTTAGAEYCGYAVMMEADAFRFHTTYLNTTMFWKENAG
RVPVILNWVVGNETCVVASKKADSYACRSNNSKCIDSSNGPGYLCNCTDGYSGNPYLTDG
CQDIDECAVNVPRPCPGHCINIPGNYSCPNEMPPSSSGPVVLVVGLSTGVVIVVITITGT
YLILERKKLAKIKRKYFHQHGGMLLLQEIRLKQGTAFSIFSEAELIQATDKFDDKNILGR
GGHGTVYRGTLKDGSLIAVKRCVSMTSEQQKKEFGKEMLILSQINHKNIVKLLGCCLEVE
VPMLVYEFIPNGTLFQLIHSDNGCHNIPFSGRLCIALESALALAYLHSWASPPILHGDVK
SSNILLDENYAAKVSDFGASILAPTDKSQFMTLVQGTCGYLDPEYMQTCQLTDKSDVYSF
GVVLLELLTGKMAFNLEGPENERSLSLHFLSAMKEDRLIDIIDDHIKSDNDTWLLEEVAE
LAQECLEMSGDRRPAMRDVAEKLDRLCKVMQQPWVPAQHDPEEMESLLGQSSVASLEIVS
TGNFSMEKRILQWLLESGR
Download sequence
Identical sequences C5Z4Z9
XP_002437921.1.57931 XP_021304497.1.57931 jgi|Sorbi1|5061367|Sb10g004810 4558.Sb10g004810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]