SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5061368|Sb10g004830 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5061368|Sb10g004830
Domain Number 1 Region: 289-577
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-73
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5061368|Sb10g004830
Domain Number - Region: 187-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5061368|Sb10g004830
Sequence length 633
Sequence
MPVANILLLQGQVRVMSYIASMCHNRSTTTFLDLAGTPFTVSEKENVFTVVGVDTLGLMA
GTRQSAIYVIGCQTEESSPKNLAAVEGCTGVGCCQVALSSNVSYQQFSFGNSTSDRNISA
IDDKRHCRYAMVVEADKFKFRTAYLNTTTFWDEHNGEVPIILNWAVGNKTCDAAKKDAAS
YACRSSNSECINSTSGLGYLCNCSEGYKGNPYLHDGCQDINECALSPSPCPGRCVNRRGI
SVVIVILAIAITCSYLTRERRKLANIKERYFRQHGGLLLLEQISTGQGTTFTIFTEAELM
EATDQFDDKNVLGRGGHGTVYKGTLKNGILVAIKRCISMTDEQRRKEFGKEMLILSQVNH
KNIVKLLGCCLEVEVPMLVYEFIPNGTLFHFIHGVSGCCDAPFSTRLQIAHESALALDYL
HSCASPPILHGDVKSSNILLDDKYSAKVSDFGASIVAPTDESQFVTLVQGTCGYLDPEYM
QTCQLTDKSDVYSFGVVLLELITGKKALNLEGPESERSLSVSFLCALKEGRLMDVIDDHI
KGEENVGMLEEVADLAKQCLEMAGENRPAMRDVTERLGRLSRVTHHPWMQRDPEEMESLL
AVREPSVDGVEMVSTTFLTMERTVGRGLLEFGR
Download sequence
Identical sequences jgi|Sorbi1|5061368|Sb10g004830 4558.Sb10g004830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]