SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5061733|Sb10g019330 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5061733|Sb10g019330
Domain Number 1 Region: 184-236
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000949
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5061733|Sb10g019330
Domain Number - Region: 66-74
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5061733|Sb10g019330
Sequence length 319
Sequence
MDRSRSKRGYHYDQDSPPPRSKQRFDRRSGGGGGGQNANSSYHRRGPPSGGGGSDRRAFL
PPDAAPPPPPPPPPSTAAAGGGAGPTTTTSFRILCPECKAYGFPPGFVAKVRDESGAFVT
VHPPFAGDYVRIIETVDGARREADGRPPMFSPAQEALLMVHRRILETDADDGDEDGEYGP
RGKDPRDRGKTTTRLIVPKLHVGCLLGKGGKIIEQMRMETKTHIRILPRDQHTPRCVSLS
EEVVQSLEFLRKMNIWVVFNRCLHMRNLWDDLISLGTTLAWSHQDMSLIQMVARSLNIQI
SCTMTSFFESYAQMTRLTV
Download sequence
Identical sequences 4558.Sb10g019330.1 jgi|Sorbi1|5061733|Sb10g019330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]