SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5061914|Sb10g023870 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5061914|Sb10g023870
Domain Number 1 Region: 139-412,529-656
Classification Level Classification E-value
Superfamily Subtilisin-like 3.93e-70
Family Subtilases 0.0057
Further Details:      
 
Domain Number 2 Region: 436-509
Classification Level Classification E-value
Superfamily PA domain 0.0000602
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5061914|Sb10g023870
Sequence length 800
Sequence
METTSVSVSVESTRRRRHTTTASTAAVLLVLLCCSLLQSPAAALASGSGNPSSYVVYLGG
HPPRDDGVSPEVASRMAADSHYDLLGAVLGDREKAREAIFYSYTKHINGFAANLEPRHAA
EIARYPGVVSVFPNRGRKLHTTRTWEFMGLERAGDVPQWSAWEKARYGEDTIIGNLDSGV
WPESKSFDDGEMGPIPDDWKGICQNDHDRTFQCNSKLIGARYFNKGWAEASRLPLDDALN
TPRDENGHGTHTLSTAGGAAVRGAGALGYGVGTARGGSPRARVAAYRVCFRPVNGSECFD
ADVLSAFEAAIADGVHVISASVGGDANDYLYDAVAIGSLHAVKAGIAVVCSASNNGPDLG
TVTNVAPWILTVAASSVDREFSALAVFNHTRVEGMSLSERWLHGEGFYPIIAGEEATAPG
SKPKDAELCLMGSLDPEKVRGKIVVCLRGIAMRVLKGEAVRHAGGAAMILVNDEASGDDI
YPDPHVLPAVHISYANGLALWAYIKSTKVATGFVVKGRTILGMRPVPVMAAFSSQGPNTV
NPEILKPDITAPGVNVIAAWSGATSPTERSFDKRRVAFNMLSGTSMSCPHVSGIAGLIKT
LHPDWSPSAIKSAIMTSATELDVERKPIQNSSHAPATPFSYGAGHVFPSRALDPGLVYDM
TIVDYLDFLCALGYNATAMEDFNKGSFVCPSTHMSLHDLNYPSITAHGLRPGTTTMVRRR
LKNVGPPGTYRVAVVREPEGVHVSVTPAMLVFREAGEEKEFDVNFTVRDPAPPAGYAFGA
IVWSDGSHQVRSPLVVKTTQ
Download sequence
Identical sequences C5Z5R2
jgi|Sorbi1|5061914|Sb10g023870 XP_002437266.1.57931 4558.Sb10g023870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]