SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5062064|Sb10g026544 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5062064|Sb10g026544
Domain Number 1 Region: 96-134
Classification Level Classification E-value
Superfamily PA domain 0.000000327
Family PA domain 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5062064|Sb10g026544
Domain Number - Region: 516-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 298-397
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0559
Family PDI-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5062064|Sb10g026544
Sequence length 638
Sequence
MAARRAPWLAGGLVAAVAVQLLMVAVPVRGRFVVEKSSVRVLAPEHIRGHHDAAIGNFGV
PDYGGTLTGVVIYPDKKATGCDEFDTKFKAKSRRPVILLLDRGECYFALKAWNAQRAGAA
AVLIADSVDEQLLTMDSPEASAGTEYVDKINIPSALVNRAFGESLKKMAQKVASAAGAGE
EVIVKLDWRESMPHPDERVEYELWTNSNDECGPRCDEQMAFVRGFRGHAQLLERGGYARF
TPHYITWYCPEAFRLTQQCKSQCINHGRYCAPDPEGDFGAGYEGKDVVVENLRQLCVHRV
ANDTGRPWAWWDYVMDYKIRCSMKEKKYTKTCAEDVVTALGLDLKKVLECMGDPEADADN
AVLSKEQEDQIGSGSRGDVTILPTLVINNVQYRGKLERTAVLRAVCAGFKEGTEPRVCLS
HDIETNECLHRNGGCWRDEATNVTACQDTYRGRVCECPVVNGVRYEGDGYTDCKAIGPGR
CALNHGGCWSETRGQQTFSACSETALTGCRCPSGFHGDGHKCEDLDECREKLACTCPGCQ
CKNTWGNYECKCKGNQLYIRGEDVCIANSMSKLGWFITIAAVACVVGIGVAGYVFYKYRL
RSYMDSEIMSIMSQYMPLDSQNNENQPLRQHDSEALRH
Download sequence
Identical sequences 4558.Sb10g026544.1 jgi|Sorbi1|5062064|Sb10g026544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]