SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5062351|Sb10g031280 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5062351|Sb10g031280
Domain Number 1 Region: 95-160
Classification Level Classification E-value
Superfamily PA domain 0.0000000157
Family PA domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5062351|Sb10g031280
Sequence length 536
Sequence
MAAAAVLALLTVSVLAGAAAGGDIVHHDDEAPKIPGCNNDFILVKVQSWVNGKEDGEFVG
VGARFGPKIVSKEKHANRTKLTLADPMDCCSPPKHKVSGDVLLVQRGKCKFTKKAKFAEA
AGASAIVIINHVHELYKMVCEKNETDLDINIPAVLLPKDAGSALHTLLTDGNAVSVQLYS
PDRPVVDTAEVFLWLMAVGTVLGASYWSAWSAREAVIEQEKLLKDGHESLLNVEAGGSSG
MVDINVASAIMFVVVASCFLIMLYKLMSYWFVELLVVIFCIGGVEGLQTCLVALLSRWFK
PAAESFVKVPFLGAVSHLTLAVCPFCVAFAVLWAVFRQLPFAWIGQDILGIALIVTVIQI
VRVPNLKVGSVLLSCAFLYDIFWVFISKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMF
DPWGGYSIIGFGDILLPGLLVAFALRYDFSAKKGFRSGYFLWAMVAYGSGLLITYVALNL
MDGHGQPALLYIVPFTLGTLIALGWKRGELPNLWTRGEPERVCTHMHMPLLPTTPN
Download sequence
Identical sequences C5Z2N7
jgi|Sorbi1|5062351|Sb10g031280 XP_002439083.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]