SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5028048|Sb01g003020 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5028048|Sb01g003020
Domain Number 1 Region: 332-627
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.42e-77
Family Protein kinases, catalytic subunit 0.000078
Further Details:      
 
Domain Number 2 Region: 32-287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-68
Family Legume lectins 0.0000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5028048|Sb01g003020
Sequence length 689
Sequence
MAAAAAVTAVRVLVPVLLLALARGGGSAPAAPVQFTFTGFARENVTTSGAAAVATGGGLL
QLTNATNWVFGHAFYPAPLRFKDPATGAPISFSTTFVAAILPRYPDAHGHGLAFALAPSA
AGPAQAVAGKYLGLFNTSDNVGNGTTSEVVAVELDTAMDVEFDDINNNHVGVDVHSLRSV
ASKSAGSVDVALASGKLLQVWIEYDGATTRLEVTVSAAAVGVPRPPVPLVSCKVNLSSAV
ADQTYVGFSAANGAASSSHYVLGWSFLLGGGRAPDLDLSKLPRLPPPPSGHKKATELPLL
LSLILLAVVVLLVASAAVTLCVVWRRRRFAEEQEDWEVEYGPHRISYRDLHAATRGFRDV
IGGGGFGVVYRGMLPPQPGGVEVAVKKTRGRALREFVSEIASLSRLRHRNLVQLLGYCRR
RGELLLVYDYMVNGSLDKRLFGAGGNEPALSWEQRAKIVRDVAAGLLYLHEGWEQVVVHR
DIKSANVLLDGDMNGKLSDFGLARLYDHGSDSRTTHVIGTLGYLAPEMIKTGKATPSSDV
FAFGAFLLEVACGRRPMESLGNNGDPAGLVDSVLDRWKAGRIKDARDPRIGKCDEDDLEL
VLKLGLLCSHPDPRCRPNMREVVQILEGAAPVPETPPEDLGGAGVRIFGCYESFDEFVNV
FPATFEITAATPPPPCSPSSAEHHQLISG
Download sequence
Identical sequences jgi|Sorbi1|5028048|Sb01g003020 4558.Sb01g003020.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]