SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5029091|Sb01g020940 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5029091|Sb01g020940
Domain Number 1 Region: 325-623
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-79
Family Protein kinases, catalytic subunit 0.0000749
Further Details:      
 
Domain Number 2 Region: 25-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.79e-72
Family Legume lectins 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5029091|Sb01g020940
Sequence length 679
Sequence
MAAKTWQLMVVVVMIVGMGVEPCGAVEFAYDGFGGATGLHLDGMATVTPAGLLQLTNDTS
MPKGHAFHPEPVTFRRPAASAMSSFSTTFVFAIVSEFLDLSTSGFAFLVAPSTDLSTAMP
NQYLGMFNGTDNGDARDRVFAVELDTVRNPEFADINNNHVGVDVNSLNSSAAAPAGYYDA
ATGAFRNLSLISREPMQVWVDYDAATTEITVTMAPAPAPSRPQRPLLSTKIDLSTVITDT
AYVGFSSASSIVLVKHYVLGWSFSLGGAAPALDYAKLPKLPRIGPKPRSKALTIALPMAT
TVSVLAALAVAFFLLRQRLRYAELREDWEVEFGPHRFAFKDLYAATGGFKDSCLLGAGGF
GRVYRGVLPGSDTEVAVKKVSHGSRQGMKEFVAEVVSIGHLQHRNLVRLLGYCRRKGELL
LVYDCMPNGSLDKHIHGGAGNCKPVLDWAQRLHIIRGVAAGLLYMHEDWKQVVIHRDIKA
SNVLLDGEMNGRLGDFGLARLHDHGSDPHTTRVVGTMGYLAPEVVRTGKATTLSDVFAFG
VFLLEVACGRRPIEDNGGECTMLVEWVRGHWRNGSITGAMDARLGSGSGYDAMEADMVLR
LGLACLHPSPAARPTMRQVVQYLDGGVHLPELPAIYTSSFNVFAGMERHQRLFDSWSVRQ
STAAISVATISDIGLSGGR
Download sequence
Identical sequences C5X0G9
XP_002467174.1.57931 4558.Sb01g020940.1 jgi|Sorbi1|5029091|Sb01g020940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]