SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5030185|Sb01g040600 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5030185|Sb01g040600
Domain Number 1 Region: 27-283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.6e-72
Family Legume lectins 0.0000788
Further Details:      
 
Domain Number 2 Region: 340-539
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-48
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5030185|Sb01g040600
Sequence length 580
Sequence
MVSVRSISILLLFVLHKIERVSSANNEQFTYEGFTGANLTLDGAAAVTPSGLLALTNDKH
TKGHAFFPAPLHFHRPVSGTTLQSFSATFVFAISSEHAQLSDHGLAFVLAPSSNLSDATG
AQYLGLLNISNNGKPSNHILAVELDTVLSPEFHDIDSNHVGIDVNNLQSMESHTAGYYED
GTGKFLNLTLMSRKVMQLWVDYSGQAMELNVTLAPLDVEKPKDPLLSTAINLSEIVNTTA
YVGFSSATGLSIAYHYILGWSFSLNGAAPVLNSSNLPELPRLPHQKRSLSETLVIVLPFA
TAGFIIALLIVVFMFMQRWLRYAELREDWEVEFGPHRFSYKDLFHATKGFSRPVLSWNMR
FHIIKGIASGLLYLHEDWEQVVVHRDIKASNVLLDSEMNGCLGDFGLAKMYSHGTNPRTT
NVVGTMGYLSPELLRTGKASPGTDVFAFGMFLLEVTCGRRPLEHDQVVLLDWVLEHWNKG
AILDTVDARLSDQYSAEEASLVLKLGLLCLQPMPNARPSMRQVLQYLDGTLTVPEMAMMN
LDYGTLMFLQSEGFDSYAMLDASSFATTSIGPGSDLSGGR
Download sequence
Identical sequences jgi|Sorbi1|5030185|Sb01g040600 4558.Sb01g040600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]