SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5031395|Sb10g011010 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5031395|Sb10g011010
Domain Number 1 Region: 28-287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.13e-75
Family Legume lectins 0.0000756
Further Details:      
 
Domain Number 2 Region: 331-607
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.02e-60
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5031395|Sb10g011010
Sequence length 635
Sequence
MLFVRLLLLIVFLGLHPQASSDTTADDDQFVYSGFRGSALTVDGTAAVTSDGVLLLTNGT
AYLKGHAFHPTPLRLRDSPNGSVQSFSVAFVFGIVSVYPDFSAHGMALLIAPGKDFSSAL
PAKYLGLTNVQNDGNASNHLLAVELDTIQSVEFKDINANHVGIDVNGLQSLRSYNAGYYD
DGSGEFQNLKLISRQAMTVWVDYSGDKKQINVTLAPLLMATRPARPLLSVSYDLSTVLTD
IVYLGFTSATGRVNSRHCVLGWSFGKNRPAPAIDVSKLPDLPRAGPKPGSKVLEIVLPIV
TGALVLCFGGAGVLLVRRRFRYAELREDWEVEFGPHRFSYKDLYQATDGFKDKNLLGEGG
FGRVYKGVLVPSMLEVAVKRVSHESRQGMKEFVAEIASIGRIRHRNLVQLLGYCRRKGLL
YLHERWEKVVVHRDIKASNVLLDADMNAQLGDFGLARLYDHGTDSQTTHVVGTVGYLSPE
LLRTGKASPLTDVFAFGIFLMELTCGQKPIKENEQGGGGGGHVMLVDWVLQHWRNGSLVA
TVDAGLRGEYDVGEAELVLKLGILCSHPFANARPGMGQVMRYLDGVTPLPELTPTDSSFD
VLAMMMQGEDFGMSSFSHPDTVASFGTISNLSGGR
Download sequence
Identical sequences A0A1W0VSL9
jgi|Sorbi1|5031395|Sb10g011010 4558.Sb10g011010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]