SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5032517|Sb02g002290 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5032517|Sb02g002290
Domain Number 1 Region: 823-1137
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-77
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 495-763
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.19e-68
Family Legume lectins 0.00016
Further Details:      
 
Domain Number 3 Region: 219-467
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-53
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 4 Region: 20-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.59e-33
Family Legume lectins 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5032517|Sb02g002290
Sequence length 1167
Sequence
MVFSKSLAFAIPFLLRLVVAAVGDEEFVFNGFNDSSGWTLQGSAVVLPNGILNLGATNSS
SVAYPNSLAFYPSPFQMRNLTDSSTFSFSATFAFAILPYEDSARDGIAFVIAPNTSFTNV
TRYDYFGLLDREDSGKSSNHLAYIELDIWCDREFGDIDNNHVGININSLKSSRSSPAGYY
MDDPFSDLHPLRLSSGKVMQLQAVRRCYRYREIREDWELEFGPHRFSYKDLFHATDGFKD
KQLLGTGGFGKVYKGVLPSSKLKVAVKVMSHDSKQGMKEFIAEVRFEIIKGVASGLLYLH
EEWEQVVIHRDVKASNVLLDGEMNGRLGDFGLARLHDHGVEAHTTCVAGTRGYISPELAR
LGKATKATDVFAFGAFILEVACGRRPIGVNSHGEPQLLVDFVLKFWQRDLIVCMMDPRLE
GEYVREEAELVLKLGLLCSHPSPVNRPSMRLVMQYLCGDTPFPEMPDAYLNIRSITFVLL
CLGLNLPGFGDAGNESFVFSGFPAGGADADLITLDGDGTVTGEGLLELTNNETDSKGHAF
YRNPVQFKDSSNGTVQSFSVAFVFAIMSAYSDFSSDGMAFVIAPGKDFSNASGAQYLGLG
LLNSTTSSNNGPSSDHFFAVELDTIKNNEFHDIDANHVGVDINALSSVYSHTAAFHDETD
DGALTTFSLISSHGKAMQAWVDYDGQSKQLNVTLAPMGVTKPSKPLLSNTTDLSPVITDD
KAFVGFSGATGPGGSQHCVLAWSFAVNGPAPPIDFTKIPKLPNSNSNSNSNSSHHHEAAG
GVKGLEIGLPIAAFVFILTTCITAILLVRRHLTYAELREDWEVEFGPHRFSYKDLFQATE
GFKSKHLLGAGGFGKVYKGVLPNSGTEVAVKRVSHDSSQGLREFISEVVSIGHLRHRNLV
QLLGYCRRKHRELLLVYDYMPNASLDKYLYGEDDKPLLEWAQRLQIVKDVASGLFYLHEK
WEQVVVHRDVKASNVLLDGAMVAHLGDFGLARLYDHGADLQTTHVVGTMGYIAPELARTG
KASPLTDVYAFGTFLLEVTCGRRPVLVDTVHHGRKLLVDRVLECWHRGSLEETVDSRLQG
NYNVDEARMVLMLGLMCSHPFPGERPTMRQVMQYLDGDTPLPELTPADMSLLSLMQNQTS
FDQAALQYPWSGSSMGTMTTPDISCGR
Download sequence
Identical sequences jgi|Sorbi1|5032517|Sb02g002290 4558.Sb02g002290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]