SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5033625|Sb02g022310 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5033625|Sb02g022310
Domain Number 1 Region: 3-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.6e-39
Family Legume lectins 0.00028
Further Details:      
 
Domain Number 2 Region: 211-355
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.53e-16
Family Protein kinases, catalytic subunit 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5033625|Sb02g022310
Sequence length 374
Sequence
MERLTGNTTSRSGRVSYNRPVRLRSDDASGEVSSFSASFSFVVVNGRPRQRQAPVDTGGG
LAFFVERYPSRMPPNSQGGCLGLFDRTTATSADPMLAVEVDSHGDFGWDPIMSPHIGVDI
STLQSGKNSYKAVDGIVDGAPYILQIDYSDVTKDLDVVLRSSSSSSTAGVPLVALKKSID
LSGFLPPESEVAIGISAATGASNMATHHLLWWSLKIALGVGSAIEYLHGLYRPLRHGNIR
ADNVMLDELFNAKLGGFDAAASSKGSLSDDVLAFGALLLELVRGRRCQTTASACCTNHQA
VNAAILDYDDQCLDGQFDREEVQRVMLVGLWCSHPDKWQRPTMAQALRYLMSEDPLPTAI
TEQASKSVADFWTL
Download sequence
Identical sequences jgi|Sorbi1|5033625|Sb02g022310 4558.Sb02g022310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]