SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034068|Sb02g028560 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034068|Sb02g028560
Domain Number 1 Region: 401-630
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-53
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 
Domain Number 2 Region: 288-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family EGF-type module 0.0079
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034068|Sb02g028560
Domain Number - Region: 258-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034068|Sb02g028560
Sequence length 672
Sequence
MESSRPLLISFLPSVWVVAVAAAAAATRSPGCATRCGAIDVPYPFGLDPQCAIHDGFQLN
CTTVGRTTKLFYLNVEVTKISVEDGKAWLKTWISRQCYNQTTNDMFVENAWINATDTPYV
LSADDNKIIVLGCNIMAYMQSDSYVIGCMSTCDDPLKNGSCSGTAGCCEAELPRGVRYYQ
GFFNGLYNTTQIWRNTPCNYITVMESAAFNFSTTYLTSTAFYDSDDSRTPVVMEWGIARQ
TCEEARANETAYACVSDHSDCVYSDAAGYRCSCSKGFEGNPYIVDGCTDINECLDNFKYP
CAGICENTLGNFTCSCPRGRNMINGVCVKSQRSTWMLPLVGASVGLVTLVIGITCAYLVR
ERRKLHRIKQRYFRRHGGLLLFEEMKSQHHQGAAFTIFSEEELQQATNNFDGQRVLGHGG
HGTVYKGVLKSGDTEIAVKRCMTIDEQQKKEFGKEMLILSQINHRNIVKLLGCCLEVEVP
MLVYEFIPNGTLFDLIHGDHSRQQHVSLDTRLRIAYESAEALAYLHSCASPPILHGDVKS
TNILLDGDYTAKVSDFGASILAPNDKSQFVTENKLEDIVDDQIKNSENLEYLEEIAELAR
QCLEMSGVNRPSMKEVADKLDRLRKIMQHPWAHENPEELDKLLGEPSTANSTATTGNFSI
TKRAAMGLESGR
Download sequence
Identical sequences jgi|Sorbi1|5034068|Sb02g028560 4558.Sb02g028560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]