SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5035184|Sb03g004860 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5035184|Sb03g004860
Domain Number 1 Region: 486-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-72
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 62-198
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.98e-29
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Domain Number 3 Region: 328-380
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000208
Family Anti-platelet protein 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5035184|Sb03g004860
Sequence length 788
Sequence
MARFLSLFVLPLLTLLPSSYASPQQMLRTGSSLLVEDYKQSFLTSPNADFSCGFYEVGGN
AFSFSIWFTNTMEKTVVWTANPKSPVNGHGSMVSLNHGGNLVLTGVNGTVTWDSKTSSGK
GTTVALLDTGNLIIRDSNGAVLWESFSSPTDTLLPFQALTKATRLVSGYYSLYFDNDNVL
RLMYDGPDISSIYWPSADYSVFQNGRTNYNSTRVAVLDAEGYFLSSDGLNIKSSDWGTVI
KRRLTVDYDGNLRMYSLNASDGKWIISWEAIAKMCDVHGLCGQNGICQSSPRFHCSCPPG
HEMIDPHIWNKGCRPQFSKSCNNIEEFQFIKLPRTDFYGFDQTFNQSVSLEECSKICLDA
CSCSAFTYKKGPGLCYTKAVLFNGYSDPSFPGDNYIKLPKDLGISTSLVSRKSHLTCNRN
IPEIVEGSASMYGMSSVDKKWTTYYVFAAILGALVLLFTGTSWWFLSSKQNIPKSMEAGY
RMVTSQFRMFTHQELREATGKFKEEIGRGGSGIVYRGVLEDKRVVAVKKLTNFSHSEEEL
WAEMSIIGRINHMNLVRMWGFCSERQHKLLVYEYVENESLDRYLFGNVSSERLIAWSQRF
KIALGTARGLAYLHHECLEWVIHCDVKPENILLTRDFEAKIADFGLAKLSKRGSSSFNLT
HMRGTMGYMAPEWALNLPINAKVDVYSYGVVLLEILTGTRISSGITVDGMEIELRQFVQG
LKQFLESGDVKDIVDHRLQGHFNPEQAKVMLQVGIACLEERNSRPTMNDIIIELLACADQ
DDHPAYSW
Download sequence
Identical sequences C5XNJ6
XP_002457285.1.57931 jgi|Sorbi1|5035184|Sb03g004860 4558.Sb03g004860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]