SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5035784|Sb03g014450 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5035784|Sb03g014450
Domain Number 1 Region: 391-675
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-71
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 287-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000692
Family EGF-type module 0.0039
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5035784|Sb03g014450
Domain Number - Region: 257-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00442
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5035784|Sb03g014450
Sequence length 732
Sequence
MASMLLLGVAVMLYLASTSAQPAPGCQARCGDVEIPYPFGIGKDCAIDAGFKINCNTTAS
GIKKPFIGNVEVLNISVSRGKTRALNKMSTYCYDHTTTKMEENLWWLDFSKWPYRFSNTD
NRFMVIGCNTLAYIYNINNRTGYTTACASVCASPRALTNGSCLGVGCCQNDIPNGLTRYD
VQFYSVYNDSDSWRFNPCSYAALVESETFNFSSEYITTMKFNETYGGHQPLVLDWAIGNV
TCDVARSLPSYACRDRQSLCVDSVNGPGYLCTCPKGYKGNPYLSDGCTDVDECKENPSQC
PKGATCRNTAGDYRCSCPPGRKFSKDTNSCNPDIHLIIGVCISSIVLVIIIFCIRLIFER
RKLSNIKQQYFQQHGGLLLFEKMKSDQGLAFTVFTEAEIEQATNKFDSSQILGHGGHGTV
YKGIMRDDIPAAIKRCALIDDRHKKEFGKEMLILSQINHKNIVKLLGCCLEVEVPMLVYE
FIPNGTLFDLIHGKNRTLHIPFSSLLRIVNEAADGLAFLHSYANPPILHGDVKSSNILLD
ENYMAKVSDFGASILAPTDEAQFVTMVQGTCGYLDPEYMQTCRLTDKSDVYSFGVVLLEV
LTGQMPLKLESNELQRSLSSNFLLAMKENNLDSMLDSQIKGNENIELLRGLAELAKHCLD
MCGDNRPSMKEVSDELSRLRKLSKHPWIQRDTELESFLGGQSMNSFGIDQSTEYSGKVEE
MAINPSSSYYVR
Download sequence
Identical sequences C5XKI2
4558.Sb03g014450.1 XP_002457827.1.57931 XP_021311050.1.57931 jgi|Sorbi1|5035784|Sb03g014450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]