SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5035937|Sb03g022080 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5035937|Sb03g022080
Domain Number 1 Region: 446-730
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-76
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 341-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family EGF-type module 0.0091
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5035937|Sb03g022080
Domain Number - Region: 293-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000267
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5035937|Sb03g022080
Sequence length 786
Sequence
MPQLLETAIDDISGSAGGVVMVPAAALMLVLQLFSLASAAQSGNVGPPPTCPSSCGNLSV
PYPFGIGASCSLPGFNLTCDRTRHPPRLLVGDGALQIVEISLANSTVRALYTAGAVNINF
STSATSVDGSGTWSGGLGAASDSPYVVSEWRNQLVVTGCNVQGTLLGGSGNVITGCSSFC
SIDDKWTGAVVTTPDEGATACSGIRCCETPIPIGRPSYNVQFKYLDVENTGLLPVAVRIA
EHGWFDSVAAQMLNNSVRDSTLGTPVPVVLDWAVASTPIVPGTPAADAAGNSSCPSDAAR
SACRGSHSACHNVTNNYRTGYVCRCQNGYDGNPYLSSGCQDINECEVPGNCFGICTNTDG
SYECRCPRGASGNPYVEHGCIKSSLGLSIGLGVGSGAGLLVLVLGAVFVTRRIKHRRARM
LKQKFFKQNRGHLLQQLVSQKADIAEKMIIPLIELEKATNNFDKARELGGGGHGTVYKGI
LSDQHVVAIKKSKVAIQREIDEFINEVAILSQINHRNVVKLFGCCLETQVPLLVYEFIPN
GTLYDHLHVEGPATLSWECRLRIATETARALAYLHMAVSFPIIHRDIKSHNILLDGSMIA
KVSDFGASRCIPTYNTGISTAIQGTFGYLDPMYYYTGRLTEKSDVFSFGVVLIELLTRKK
PYSYRSPKDDGLVAHFTALLSEGNLVHVLDPQVIEEAGEQVGEVAAIAASCVKMKAEDRP
TMRQVEMTLESIQAPVQNVVQRTGTRICDEKQKAVMYPLVEGTSKQESSRQYSLEEEYLL
SARYPR
Download sequence
Identical sequences jgi|Sorbi1|5035937|Sb03g022080 4558.Sb03g022080.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]