SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036241|Sb03g027890 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036241|Sb03g027890
Domain Number 1 Region: 444-554
Classification Level Classification E-value
Superfamily TPR-like 1.06e-25
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 
Domain Number 2 Region: 206-379
Classification Level Classification E-value
Superfamily TPR-like 6.17e-25
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 579-662
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000114
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036241|Sb03g027890
Sequence length 681
Sequence
MSEADRIRHRTAALALHDDEVRDKPDAKANVFADLGSPVSPLRARASVATSSSSSSGSAK
SPAPSNAGMAGGRSHSGELVGECNPPRLMAHRRSGSGQLIFSGSSSSRGSGGGDRGSTAS
SPMLNALPTGNICPSGRVPATAGAPPPPRSRPDVLGSGTGHYGHGSIMRGAGMAPARSSI
DSSSFLGHSSRSPVSFPASSGSLQEVTRLGNEWYKKGKYGEALRHYERAVALCPESAACR
GNRAAALIGLGRLADALRECEEAVRLDPVSGRAHSRVAGVCLRLGVIDKARRHFTQAGHL
QQSDPAEWQKLQEVEMHLGRCTDARKIGDWKSTLREADAAIAAGADSSQLLLALRSEALL
RLHKLEEAESTLGSMLKLDGALPSSLTAAKLSGMLAESYVHIVRAQVDMALGRFDTAVAA
AEKARDLDPGNAEIGMVLNNVRLVAKAREQGNDLFKAAKFSDASMAYGEGLKYDPSNSVL
HCNRAACWSKLEKWEKAVDDCNEALRIQPNYTKALLRRAASYAKLERWVDCVRDYEVLRK
ELPSDKEVAEALFHAQIALKATRGEDVSNMKFGGEVEIVSNVEQLRAAISSPGVSVVYFM
SAMNQQCTQITPSVNTLCTECPSVNFLKVNVDSSPMVAKAENVRIVPTFKIYKGGVKVKE
MICPSLHVLRYSVRHYSVSSS
Download sequence
Identical sequences C5XR15
XP_002455953.1.57931 4558.Sb03g027890.1 jgi|Sorbi1|5036241|Sb03g027890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]