SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5037367|Sb04g000880 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5037367|Sb04g000880
Domain Number 1 Region: 404-711
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-76
Family Protein kinases, catalytic subunit 0.0000929
Further Details:      
 
Domain Number 2 Region: 292-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000299
Family EGF-type module 0.0076
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5037367|Sb04g000880
Domain Number - Region: 257-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0493
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5037367|Sb04g000880
Sequence length 736
Sequence
MGRVLPWLIFAATLLLASINSSTASRMARPGCRETCGNLTIPYPFGIGSGCYYQQGFDVS
CEDNRTFLRNSSSRMEIYNISLLQGQVRVSTLIASKCYYDENRTTDGWSSARTGRFFTIS
SKANKFTAIGCYTLGYLGGYNKQRTGTGCLTMCLDKQGVDQSALCSGMGCCQTSIAPNLT
SINITFDGGYSNSEVRDFNPCSYAFVAEQDWFKFNASYLEGNNFTDKFKDGVPSVFDWVS
GNQSCDEAVKDRSSYACISKNSQCINSPNATGYLCNCTDGFEGNPYLADGCQDINECENL
VQYPCHGICKNTIGNYSCSCPAGTRSIDPKSSTCTPDAASERAKLTKMFIGISSCAIILL
ICFFALLIECQKKRLMREKEEFFQENGGLLLYEQIRSKQIDTVRIFTTEELKQATNNFDS
SREVGRGSYGTVYKGILKDNRIVAIKRSKIMNMVQKDDFVQEMIILSQINHINVVRLLGC
CLEVEVPMLVYEFMPNGTLFDLIHVTYRRPSISLDARLRIAQESAEALAYLHSSASPPIV
HGDVKSPNILLGDNNIAKVTDFGASRMLPKDEIQFMTMVQGTLGYLDPEYLQERQLTEKS
DVYSFGVVLLELITGKTAIYSEGTKEKKSLASSFLLALKESRLESILDRNILGVGMELLQ
EVAQIAKRCLSMKGEERPLMSEVAERLRFIRRTWREQLSEHASEETECLLETPSNYDPSS
TGRHGSLMGLDLEIGR
Download sequence
Identical sequences C5XS69
jgi|Sorbi1|5037367|Sb04g000880 4558.Sb04g000880.1 XP_002453154.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]