SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5037811|Sb04g007510 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5037811|Sb04g007510
Domain Number 1 Region: 76-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-25
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5037811|Sb04g007510
Domain Number - Region: 362-393
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.018
Family Hairpin loop containing domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5037811|Sb04g007510
Sequence length 438
Sequence
MKMSACPTAVVLFLFLSLPSSCSSDDRLVVGKPLSAGGVIVSDGGSFSLGFFSPANSTPA
KLYLGIWYNGIPELTVVWVANRETPLTTATGGSGSSVSAPALAVTNTSNLVLSDADGRVV
WATNVAAVADTPAGTGGTVATLTNEGCLVLRSPDGTTLWQSFDHPTDSFIPGMKFRFRMT
SGGGDRLVSWKSPSDPSPGSFTYGLDQVGNGSRPLWRSTVWTGYRSSIHYMANISAHVYL
GVNAGDGEIYMGFSVSDGVSRARYVMSYTGKLRVQSWNNASLRWDELIAWPPNECSRYGY
CGPFGYCDNTDGGGAAAAAVPACKCLDGFEPTSSEDWSRGNFSRGCRRRQALTCGGDAPD
GFVHVRNRSHDECAAECSGNCSCVAYAYANLNTSTINGDSTRCLLWVGELIDAEKIGVDD
EAGDETLHLRLSGLDTVI
Download sequence
Identical sequences 4558.Sb04g007510.1 jgi|Sorbi1|5037811|Sb04g007510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]