SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5038002|Sb04g010190 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5038002|Sb04g010190
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000262
Family SGL-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5038002|Sb04g010190
Sequence length 132
Sequence
MKVRSDDGEAQVGQANGSAVFHFVNGLDGDQAMGDVYITDSNATYPRRFNTETMITVLKA
DLPYPNDVAVSSDRMHVVVAHMVPCQAFRYWLKGPKTGQYEVALNQEKARLDAVVAPPVK
HLVGVRPAQCRW
Download sequence
Identical sequences 4558.Sb04g010190.1 jgi|Sorbi1|5038002|Sb04g010190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]