SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5039775|Sb05g005800 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5039775|Sb05g005800
Domain Number 1 Region: 700-985
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-73
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 593-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000255
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5039775|Sb05g005800
Domain Number - Region: 559-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0383
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5039775|Sb05g005800
Sequence length 1046
Sequence
MKKGKDVGLESVASPSSRTAPPLPPSPPLRPAAAGSRLLVVLDCAVSAPTPFRRVGGRAL
FRAWRGVEWPNQARFLFWPAQTERHFEADLASKRAGGNPHGLSSETGHSGRNERRLNEFV
VAGCNVINVIATISGDVVGEKNPKIVSGCASLCTKTNSGGDVYFGEATDRSCTCMSGCCL
APLTAGGVPKPNGVQARWLYSGNDHTVEQTALPITVFVAEQGWTEKELERTGGFQFQEAP
LLLDFAVTQGLPPYREGNRSCSQDVQRMVCKSEHSFCNARDIGYTCDCDYGYDGNSYLAG
GCQADAVSSSNCSTSCGAVSVPYPFGFGPSQCYWPGLNLTCDTRHSPPRLLLDSNSALQV
VQISLHNSTVHVIHHHSSDDFKNYTVANDDGGPFSPMGMTNVGLPDIGDPYVLSTRNEFI
VISKWHLRGATLYGEYRNGRSNTDSIISRAVCSSGSPVGDRGYCSGYQGCCHAPISAGST
PKRVEFEMLSSRDNSSLNITYAFISEMGLTDEWHQIFNMNDQNNFISSPIVLQWAVKKGL
SVSVADSSGKCPAGVTSSLCQSENSDCRQENGGFTCHCSNGFDGNPYVAHGCQDIDECNN
LALRKTCVDLGGSCFNYPGGYECQCPPGMHGNVYQPGGCIVVKKSATPASGPALLLALGI
WFLLSKLKQHRIKLLKQKYFKQNRGQLLQQLLSQKADIAETMIIPLDELAKATNNFDKSR
VIGGGGHGTVYKGILSDLHVVAIKKSMITLQKEIYEFINEVAILSQINHKNVVKLLGCCL
ETEVPLLVYEFIPNGTLDQHLHIQEPKRSLSWSSRLRIATEIATSLAYLHSSVSIPIIHR
DIKSSNILLDDTMTSKISDFGASRYIPINKTELTTIIQGTFGYLDLECFHTGRLTEKSDV
YSFGVILVELLTRKKPTCQHLSNEYGGLVPHFLNLLASRNLAHIIDPQVLEEGSTEVQEV
AMLAASCIKLRGEERPTMRQVEVTLEGLQQRSNKIYKKDDMVSKEYENAGIGANYSSWTK
EGHKLEESSRRYSMEQEMVMSARYPR
Download sequence
Identical sequences jgi|Sorbi1|5039775|Sb05g005800 4558.Sb05g005800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]