SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5041789|Sb06g016370 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5041789|Sb06g016370
Domain Number 1 Region: 493-754
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-71
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 74-172,204-236
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-25
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5041789|Sb06g016370
Domain Number - Region: 380-426
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Anti-platelet protein 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5041789|Sb06g016370
Sequence length 782
Sequence
MPLSLLPFVFIFFPLSILEVHSSASAPAPGRDTNTMLPGQTLAGSDKLVCSTGKYALGFF
QSQTRTSGNSSCCYYLGIWINRVPTITPVWVANEDDPIADLTTAVLTMSPADGNLTVLNR
TTKSIIWSTSTQANTTTNGTIATLTDGGNLVVRRSWSPSGDVLWQSFDHPTNSLLPGAKL
GRDKVTGLNRRLVSRKNSADQAPGAYALELDPTGAAQFILVEQNSGVTYWSSGEWNGRFF
DAIPDMGAYSEFVDNNREVYLVTPLRDDNMVMRLSLEVSGQLKAFIWYEQLQDWVISAVQ
PKSQCDVYAVCGSYSVCNDNVSPSCDCMKGFSIKSLEDWELLEDRRGGCIRNSPLDCSDK
KTTDGFYSVPCSGMPSNAQSLTVVTNEGECAKVCLSNCSCTAYSFSDDHGCYVWHDELFN
VRQQQYSDLTTTKAEFLKVRLAAKELRIWENHRRKMLAWVVTSATMLALFGLVLLLMIWR
KRTMRYCRVSNSVQGGNGIVVFRYTDLQQATKGFSSILGSGGFGSVYKGVLPDGSIIAVK
MLDGLRQGEKQFRAEVSSVGMIQHVNLVKLVGFCCEGNKRLLVYEYLPYGSLDVHLYQNS
ATFLNWRNRYQIALGVARGLAYLHESCQEYIIHCDIKPENILLDASFAPKIADFGMAKLV
QRNFSGVLTTMRGTVGYLAPEWLSGVAITTKVDVYSYGMVLLEIISGRRNTYKQCTSCGH
NDAYFPLQVANNLLKGDVQSLVDPKLSGNANMEEVERACRALVGASKTRSPIDRQWVRLF
RF
Download sequence
Identical sequences 4558.Sb06g016370.1 jgi|Sorbi1|5041789|Sb06g016370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]