SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042649|Sb06g030770 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042649|Sb06g030770
Domain Number 1 Region: 410-694
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-73
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 293-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000447
Family EGF-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5042649|Sb06g030770
Domain Number - Region: 258-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0174
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042649|Sb06g030770
Sequence length 747
Sequence
MARVLPLLIVAAATLLLTSIKSSTALKMASPGCRETCGNLTIPYPFGIGPGCYYKQGFDV
SCEDNRTFMPNSSSRIQVYNISLLGGQIQVSTLIASKCNYTNGESTDGWVSVFTTPFFTL
SSKANKLTAVGCNTVAFLGGYNKRRAQTGCVSLCLDKESVDFSGQCSGMGCCQTAIAPNL
GSLNITFDKSFNNYVVNEFNPCSYAFVAEQDWFRFEASYLQDKKLTDKYKDGVPSVFDWV
AGNQPCDEAVKNISSYACISRNSQCFNSPNVTGYLCSCSDGFEGNPYLADGCQDIDECQH
PLQYPCYGICSNTVGGYSCSCAAGTRSKDPKTSVCSPDTASERAKLTKLLIGLTVGSACF
GLLFSFLGVAKITNKLKQQRIKKLRQTIFKRNHGLLLQQLISSNQDIAENMKIFGLQELE
QATNKFDQNRILGGGGHGIVFKGILADQRIVAIKKSKIAVQREIDQFINEVVILSQTNHR
NVVKLFGCCLESEVPLLVYEFISNGTLSYHLHEQSENILSWKDRLRIAVETSRAIAYLHS
AASILVFHRDIKSANILLTDALTAKVSDFGASRSISIDDTGILTAIQGTHGYLDPEYYYT
SRLTEKSDVYSFGVILAELLTRVKPVFSTPSSEVTSLASHFVSMMRDNRLCDILDPRIVE
EGSTEDIKVVAGLAEACLRLKGEERPTMRQVEITLEDLQGSKVLPNSRMASSQNAIQDES
YNGSNGSEGTRLYSLEKEFIQSSEIPR
Download sequence
Identical sequences A0A1Z5RFD0
XP_002448648.1.57931 4558.Sb06g030770.1 jgi|Sorbi1|5042649|Sb06g030770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]