SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5043397|Sb07g009340 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5043397|Sb07g009340
Domain Number 1 Region: 122-385
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-67
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 5-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000018
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5043397|Sb07g009340
Sequence length 394
Sequence
MKEHFDIDECVLRDARLDLRDTYPCSGICKNTIGGYDCQCELGMRGDAKNGTCKIVFPLT
AMVVTFGIIGVASALSILVLFKLLLEEKRKTREFFNKNGGPTLEKVNTIKIFKKEELKPI
IQSQNVIGKGGFGQVYKGLLDNQVVAIKKSINVDKSQEKQFANEIVIQSRVIHKNIVKLI
GCCLEVDVPMLVYEFVPKGSLDDILHSSPKVSLRLDIRLNIAAGAAEGLAYMHSKTSTTI
LHGDIKPGNILLDENFDPKISDFGISRLIAIDKSHTKYVIGDMGYVDPIYIQSGLLTKQS
DVYSFGIVLLELLARKKAALGENSSLIKTFLDAYTQENGAIDLFDAEIIADKDMEILHKL
SMIISECLKLEVDKRPEMTDVEAQLQNLKKAYKA
Download sequence
Identical sequences jgi|Sorbi1|5043397|Sb07g009340 4558.Sb07g009340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]