SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044219|Sb07g028190 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5044219|Sb07g028190
Domain Number 1 Region: 400-688
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-73
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 301-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000629
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044219|Sb07g028190
Sequence length 743
Sequence
MGAAVCLFVITLVLPWVVVASPAAVASGPAGSSCTSRCGNISIAYPFGVEPGCYHAAGGF
NLTCRQQQGDPPELFLGDGTVQVTDISVPSGTVRVKSQRMEFGQGPYSRGRITNGSVTWG
GGLPKGGQFFLSESKGMVLVIGCNIQVDVHASDVASYNRNSLVGSCTAVCPMLDGFDPYS
SVLPYPYLPNGSCGGLGCCEANIILGYSFYRIQIQNRSISSPSYATSLNNAGIYIIDRDS
SIDTRSLSLDGGPPVTMDWVISGSQCPTTNKSAAECRSANSFCLDYVTHVGYRGHRCHCS
YDIDECKSPDIYHCYGNCRNTAGSFTCQCPAGFTGNASFPNGCKGLSIGLGVGGGTSLLL
LALGAPYIVRKVKLQKVNKMKQRFFKQNHGLLLQQLISQSTDIGERMIITLRDIEKATNN
FDRARIIGGGGHGVVFKGILDLHVVAIKKSKIVVQREINEFINEVVILSQVNHRNVVKLL
GCCLETEVPLLVYEFISNGTLCHHLHVEGPKSLPWHDRMRIAAEVAKAISYLHSAASMPI
FHRDIKSANILLDDALTAKVSDFGASRYIPTDQTGVTTAVQGTMGYLDPMYYYTGRLTDK
SDVFSFGVLLVELLTRKRPYVYRSVNDDGLVSHFESLLAEGKLVDILDPQVMEEEDGAII
KEIATLAAMCTKLKGEDRPTMRDVEMTLESLLVKKRQQVPFNGTRQTGETDSTPYMSTSR
GTKEASRQYTMEEEMLLSARFPR
Download sequence
Identical sequences 4558.Sb07g028190.1 jgi|Sorbi1|5044219|Sb07g028190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]