SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044223|Sb07g028220 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5044223|Sb07g028220
Domain Number 1 Region: 423-616
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.63e-27
Family Protein kinases, catalytic subunit 0.0056
Further Details:      
 
Domain Number 2 Region: 318-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5044223|Sb07g028220
Domain Number - Region: 281-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000692
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044223|Sb07g028220
Sequence length 666
Sequence
MRMKVVASEKAVLALAAVLVATLPSGGAAAPAVTTATGLLGSNHCTRSCGNISIPYPFGV
EPGCYHAAWFNLTCDDSYQPPKLFLGDGTVQLLHISVENSTVRINSTAVQFQYDARTVFG
AWGVANQTWGLGLPETGPYFLSESASMVEAIGCGIQVSIIGPYDNLVSSCSAICPFYRTS
EDSVPVYWTSTNGSGSSCTGIGCCQASIALGYSFYTIQSDRIAPLSSLHGPISVHIVDQS
YSNWNDKKNNPEVLLATLDWIISRSDSLVCPTNNKTTAPECVSTHSYCRDSSSLVHNGYT
CQCAVGYQGNPYVQGGCQDIDECKYPHQYVCYGVCKNTPGSYICQCNTGYTGNVTVPNSC
TGFSIGLGVGGGTGLLLLVLGGPYIIRIIKFQKVKKKKQMFFEQNHGLLLQQLISHNTDI
GQRMIITLRDLEKATDNFDRARIVGGGGHGVVFKGILDLHVVAIKKSKIIVQREIDDFIN
EVVVSDFGASRYIPIDQTGVVTAVQGTFGYLDPMYYYKGRLTGKSDVFSFGVVLIELLTR
KKPNDYQSINGGSLVSHFVSLLAEGKLDDIIDPQVLEEEKDRELQEVAALASLCTKLNGE
DRPTMREVEMTLQNFLVKRRQVANNQSHDADITMPHYYMSTQRAKNEASRQYTMEEEILL
SASFPR
Download sequence
Identical sequences jgi|Sorbi1|5044223|Sb07g028220 4558.Sb07g028220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]