SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044633|Sb08g004830 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5044633|Sb08g004830
Domain Number 1 Region: 524-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-75
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 100-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.1e-22
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5044633|Sb08g004830
Domain Number - Region: 370-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00369
Family Anti-platelet protein 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044633|Sb08g004830
Sequence length 819
Sequence
MVSILPYWHNHGSTKNQHASKLLLSSLYLISSSTGPLYPDERVAEIAHATYLHKGSSLSV
KQPSDVIRSPDGSFSFGLYNLSSTAFTLSIWFTNAADRTIAWTANRDRPVHGSGSKVTLK
DGSMVLKDYDGTVVWEVRIRSAKVDRVELMDTGNLVMVDQGGNILWQSFNHPTNTLLPGQ
PLTATTKLVSTNPLHQSSYYTLGFDERYILSLSYDGLDISNLYWPNPDQNSWSNKRILYN
SSRRGVLDKLGQFEASDNTSFVASDWGLEIKRRLTLDHDGNLRLYSLNEPDGSWYISWMA
FSQLCDIHGLCGWNGICVYTRAAACTCPRGYVVVDPNDWSKGCKPQFKITCGKGVQQMGF
VSIPWTDFWGSDTDFVMSASLDTCRELCLESCSCVAFVYKFHPHPHGCYLKSGLFNGKTT
PGYPGVAYIKVPESFQSHSQANASDFAHGHVCNASRTHTFHYAASRGDEKGTTWYYFYSF
LAAFFLVELCFIAVGWWFMTRKQSARLAIWAAEDEEGFRVVADHFRSFTYKELQKATNNF
MDELGRGRHGTVYKGILQDNRVVAVKRLIDMTGGEAEFETEVSVIGRIYHMNLVRVMGVC
SEGTHRLLVYEFVENGSLAMFLFGSKGLLLQWPQRYKIAVGVAKGLAYLHHECMDWIIHC
DVKPENILVDEEFEPKISDFGFAKLLQRDASDSDMSKVRGTRGYMAPEWVSSAPVTAKVD
VYSFGVVLLELVMGLRVFELPTNGSGDAESALKQLLSTIGENMKTSDGNWIDDLVDPRLN
GDFVRSEVLLMLEVAALCLEHDKNQRPSMSNVLQKFLCR
Download sequence
Identical sequences A0A1Z5R535
4558.Sb08g004830.1 jgi|Sorbi1|5044633|Sb08g004830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]