SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5045412|Sb08g020035 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5045412|Sb08g020035
Domain Number 1 Region: 407-689
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-65
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 284-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000804
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5045412|Sb08g020035
Sequence length 740
Sequence
ALPPPRPSSSCQRKCGGVDIPYPFGIGPDDSPDHCSLPGFNLSCKDDGHGVLRPFYIDVE
IQNILLQQGQARMRMDMSTYCYNTSAKEMEGHTWILNLAGTPYRFSDTGNMFTVVGCRTL
AYIGDEDNVGRYMSGCVSMCRQAADVSSLSNGSCSGIGCCTTAIPKDLQYYKVWFDPGFN
TSEIYNTSRCSYAALIEESSFTFSTSYATSAAFFDAYGGQPPLLVDWAIGNETCKVAKQK
PGGLYACVDDRSECFDSANGPGYICNCSKGFQGNPYLMPLLSSNITDVDECNDDPAKYPC
SVNGICKNTPGGYECICPPHYPKGNAYNGTCEKDQTIPPKVTIPIGTTLLVGLLLFLGKE
WIKHKRRIVRQEYLSKMNECFQQNGGQLLMDMMKVESNISFQLYGREAIELATNNFHNSS
IIGEGGQGTVYIGQNLDEKNNPVAIKICKGYDESRRMEFGKELLILSRVKHGNIVQLLGC
SLQFEAPVLVYEYVPNQTLHYLIHSQDDASIRTLEIRLKIANEIASALAYLHSLNHPVFH
GDVKSVNILLSDDLSAKVSDFGCSMIRSGNETAQVVKGTMGYLDPEYLMNFELTDKSDVY
SFGVVLLELLTRRTALSKTKESLVSIFKEAVKEDKLWDDLIDREIANQENMDVVLQVAAV
ASQCLVITGEHRPTMSQIAEELHQLAGPIPHNSRAFHGVISTHMLRGRSSNNTSNYNTSE
ETTDYYNLQKKASMSIEFAR
Download sequence
Identical sequences 4558.Sb08g020035.1 jgi|Sorbi1|5045412|Sb08g020035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]