SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5048687|Sb01g018110 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5048687|Sb01g018110
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-41
Family Calponin-homology domain, CH-domain 0.0000531
Further Details:      
 
Domain Number 2 Region: 199-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 9.94e-17
Family EB1 dimerisation domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5048687|Sb01g018110
Sequence length 317
Sequence
MAASNIGMMDGAYFVGRNEILAWINTTLQLGLSKVEEAASGAVACQLMDAAHPGAVPMHK
VNFDAKTEYEMIQNYKVLQDVFNKLKITKHIEVNKLIKARPLDNLEFMQWLKRYCDSVNG
GFMTNYNASERRESSKGGKDTNRRASVPSHTPAKSATTGHKAQTSHGAKRASGQTASAPP
PRSAKPSPAANSGGPAPAYDEQITELKLLVDSLEKERDFYFTKLRDIEMLSQNPEVEHVS
VQTIQNILYASEEDAQQLPPALSPIMEASEERPKQEMANKRKSISDLDEFGMSSSSRQRL
SDISDVQLCGSPLTSFS
Download sequence
Identical sequences C5WX96
4558.Sb01g018110.1 jgi|Sorbi1|5048687|Sb01g018110 XP_002464428.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]