SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5049161|Sb01g030750 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5049161|Sb01g030750
Domain Number 1 Region: 730-1083,1185-1229
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-72
Family FAD-linked reductases, N-terminal domain 0.0000405
Further Details:      
 
Domain Number 2 Region: 1064-1175
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.64e-27
Family L-aminoacid/polyamine oxidase 0.00037
Further Details:      
 
Domain Number 3 Region: 477-570
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000564
Family SWIRM domain 0.042
Further Details:      
 
Domain Number 4 Region: 1325-1408
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000314
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5049161|Sb01g030750
Sequence length 1799
Sequence
MEDTLASIRKKLKKRKKGKESNDFGAVAECGPEVPTLVQQEDVQGVVDIGDADADEKSNL
DVVKLEGRDVSGNCAQGLDNLGLKDSLSVLFARSGRKSRQVSEEAEGMEVSCLHDGDGLN
KGSGLAPDTASKGTKRRRRRTKEEMKNACVQDRKASLPRKAKAKANGSESTRHYKVGACP
GQALGGLSSVFNELEENAADDGLFHRSSAEELLRDVEATKVLNDGSINSFNGVTDHFEIS
AWASNHPGLESYSGNLDEKTSCTAANATNVGVSDAHTCSQTLGKESSDDVDCSQGKSPTS
TIKRKTALKPKQVPGKSVRRKEAVLSVDADNKPTETTEIIEANTTMVIEENLDQLPVMGP
KDSCSSHDIVGNNPVCLGADMAAPVKDVDIVDVAAPLDYEDKENACASKVKLKRVTRGSK
KRKHGDMAYEGDVDWETLMQEQGLFSNPSAGFPDQSIKTKDQIKTSEVYEGGGDTGVAAV
RAGLKAKTITPIEKIKFKEVLKRKGGLQEYLECRNMILSRWSKDVKHLLDLADCGVSDVP
LKDELPHQALTRDVFLFLDQYGYINAGIASDKVAKGHDDTLYEVVEVPKLNESHQMESVS
IQNSIVSVSQKNEDFECGTSIECCRTVSVKNTECALVEASNEKNCPTVHCGALKLLPHLK
SDEHLTEKNNLDMSTEVRNASLPSSNLDIQRTLYLDSSVGKVEVPHQQEAREIENSGNNC
QSDRVEFAVRGKRIIIVGAGPAGLTAARHLQRQGFSVTVLEARERIGGRVYTDRTSLSVP
VDLGASIITGVEADIATERRADPSSLICSQLGLELTTLNSACPLYDVVTGDKVPDSVDED
LEAEYNGLLEELALLFAQNGDSAIGLSLEDGLEYALRKHRATQPMDSVEQDGHLRFMTNS
GAVDISVSASTGKDIDHCGKNDKIDVLSPIERRLMNWHFAHLEYGCAATLKSLSLPYWNQ
DDVYGGFGGAHCMIKGGYDTVLRNLAKGLDIRLNHVVTEVLYGPEELGASCKDGRYVKVS
TSTGSEFTGDAVLITVPLGCLKAETIKFSPSLPDWKVSSINRLGFGLLNKIVLEFPEVFW
DDNVDYFGATAEETDLRGQCFMFWNLRKTVGAPVLIALLVGKAAIDGQSISSGDHVNNAM
VVLRKLFRNASVPDPVASVVTNWGLDPFSRGAYSYVAVGASGRDYDILGRPVENCLFFAG
EATCKEHPDTVGGAILSGLREAVRIIDLLNTGNDYIAEVEALQTYQMQSDSERNEVRDMS
NRLEACELSTALSKNSSDAMYPIVSKESLLQEMFFSAKTTSGRLHLAKELLKLPTDVLKS
FAGSKEGLHTLNSWILDSLGKNATQLLRHCVRLLVLVSTDLVAVRLSGIGKTVKEKVCVH
TSRDIRAIARQLVSVWIEVFRREKDRNGGLKLLRRIPSIELSKTKSKDLQSVKPALRVPN
ETLDNNKVVSQRQRTRFASSQSPPKTNKKYENKEMKLETVTAALSDGKLLSQKQQHGIES
KVECGIPMSEEEAAAFAAAEAARVAAIAAAQAYASVEAEISVPRELPEIPSFESFVIRDH
HLDEPNTRKRALKDNFGRLECISENDSKNVKTKDLPDNTNCADADSLKISHDNCTQQNHS
NETACLANTDTGVVYGRFTRAWVDTDTICIDGVKDPLAIERWQAQAMEADKEFYSRIRIP
DEDDSCSQKQTCRSSASQGADSKPASERQSRGVEHIKQGLVNFIASLLMPLYRGKKIDRE
GYKSIMRKSVNKIIDTCSEGEKSMTTLEFLDAKRKIKIESFVNKMVDKHLHVVSKSAKP
Download sequence
Identical sequences C5WUG8
4558.Sb01g030750.1 jgi|Sorbi1|5049161|Sb01g030750 XP_002467596.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]