SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5051383|Sb02g028550 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5051383|Sb02g028550
Domain Number 1 Region: 366-566
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-44
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 
Domain Number 2 Region: 289-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000204
Family EGF-type module 0.0063
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5051383|Sb02g028550
Domain Number - Region: 259-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0401
Family Laminin-type module 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5051383|Sb02g028550
Sequence length 604
Sequence
MDWSSGLLLIISCLPAAAWVLAAAARSPGCPTMARCGAIDVPYPFSLDPQCAIHAGFWLN
CSTAADGATTLLDKNSEVTKISVEDGKAWFKTPISRQCYDSTSGDMFYNNAWVNYTTEPY
VLSADDNKIIVLGCNSMAYMLSDSYIIGCKSTCDDTPKNGSCSGTAGCCQAELPRGVQYY
QGFFNERYNTTQIWRKTPCNYITVMESAAFNFSTTYLTSTAFYDSDDSRTPVVMEWAIAR
QTCEEARANETAYACVSDHSDCVYSDAAGYRCRCSSGFKGNPYVVDGCTDINECLDNATY
PCAGICENTIGNFTCSCPRGRDMINGVCVKSQRSTWMLPVVGASVGLVTLVIGITCAYLV
RERRKLHRIKQRQQHVSLDTRLRIAYESAEALAYLHSCASPPILHGDVKSTNILLDGDYT
AKVSDFGASILAPNDKSQFVTVVQGTCGYLDPEYMQTYELTDKSDVYSFGVVLLELLTGK
KAFNLEGPENDRSLSMRFLYAMKENKLEDIVDDQIKNSENLEYLEEIAELARQCLEMSGV
NRPTMKEVADKLDRLRKIMQHPWAHENPEELDKLLGEPSTVNSPATTGNFSITKRAAMGL
ESGR
Download sequence
Identical sequences jgi|Sorbi1|5051383|Sb02g028550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]